KEGG   Homo sapiens (human): 4794Help
Entry
4794              CDS       T01001                                 

Gene name
NFKBIE, IKBE
Definition
(RefSeq) NFKB inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Disease
H00007  Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    4794 (NFKBIE)
   04658 Th1 and Th2 cell differentiation
    4794 (NFKBIE)
   04659 Th17 cell differentiation
    4794 (NFKBIE)
   04662 B cell receptor signaling pathway
    4794 (NFKBIE)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4794 (NFKBIE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4794 (NFKBIE)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4794 (NFKBIE)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    4794 (NFKBIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4794 (NFKBIE)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    4794 (NFKBIE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 Utp13
Motif
Other DBs
NCBI-GeneID: 4794
NCBI-ProteinID: NP_004547
OMIM: 604548
HGNC: 7799
Ensembl: ENSG00000146232
Vega: OTTHUMG00000014762
Pharos: O00221(Tbio)
UniProt: O00221 Q96F31 A0A024RD24
LinkDB All DBs
Position
6p21.1
AA seq 361 aa AA seqDB search
MSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPSDGSPQPCTHPPGPVKEPQE
KEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPHVGALSPQQLEALTYISEDG
DTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGAS
RALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHSLDLQLQNWQGLACLHIATL
QKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCT
PLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKISGKLLLCT
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggcgcggaaggggccggacgaggcggaggagagccagtacgactctggcatt
gagtctctgcgctctctgcgctccctacccgagtccacctcggctccagcctccgggccc
tcggacggcagcccccagccctgcacccatcctccgggacccgtcaaggaaccacaggag
aaggaagacgcggatggggagcgggctgattccacctatggctcctcctcgctcacctac
accctgtccttgctggggggccccgaggctgaggacccggccccacgcctgccactcccc
cacgtgggggcgctgagccctcagcagctggaagcactcacttacatctccgaggacgga
gacacgctggtccacctggcagtgattcatgaggccccagcggtgctgctctgttgcctg
gctttgctgccccaggaggtcctggacattcaaaataacctttaccagacagcactccat
ctggctgtacatctggaccaaccgggcgcagttcgggcactggtgctgaagggggccagc
cgggcactacaggaccggcatggtgacacagcccttcatgtggcctgccagcgccagcac
ttggcctgtgcccgctgcctgctggaagggcggccagagccaggcagaggaacatctcac
tctctggacctccagctgcaaaactggcaaggtctggcttgtctccacattgccaccctt
cagaagaaccaaccactcatggaattgctgcttcggaatggagctgacattgatgtgcag
gagggcaccagtggtaagacagcgctgcacctggctgtggaaacccaagagcggggcctg
gtacagttcctgctccaggctggtgcccaggtagatgcccgcatgctgaacgggtgcaca
cccctgcacctggcagctggccggggtctcatgggcatctcatccactctgtgcaaggcg
ggtgctgactccctgctgcggaatgtggaggatgagacgccccaggacctgactgaggaa
tcccttgtccttttgccctttgatgacctgaagatctcagggaaactgctgctgtgtacc
gactga

DBGET integrated database retrieval system