KEGG   Homo sapiens (human): 4801Help
Entry
4801              CDS       T01001                                 

Gene name
NFYB, CBF-A, CBF-B, HAP3, NF-YB
Definition
(RefSeq) nuclear transcription factor Y subunit beta
  KO
K08065  nuclear transcription Y subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4801 (NFYB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4801 (NFYB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4801 (NFYB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4801 (NFYB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    4801 (NFYB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone TFIID-18kDa CENP-T_C TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 4801
NCBI-ProteinID: NP_006157
OMIM: 189904
HGNC: 7805
Ensembl: ENSG00000120837
Vega: OTTHUMG00000170176
Pharos: P25208(Tbio)
UniProt: P25208 A0A024RBG7
LinkDB All DBs
Structure
PDB: 

Position
12q23.3
AA seq 207 aa AA seqDB search
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF
AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT
TDGQQQNVMVYTTSYQQISGVQQIQFS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggatggtgacagttctacaacagatgcttctcaactaggaatctctgcagac
tatattggaggaagtcattatgttatacagcctcatgatgatactgaggacagcatgaat
gatcatgaagacacaaatggttcaaaagaaagtttcagagaacaagatatatatcttcca
atagcaaacgtggctaggataatgaaaaatgccatacctcaaacgggaaagattgcaaaa
gatgccaaagaatgtgttcaagaatgtgtaagtgagttcatcagttttataacatctgaa
gcaagtgaaaggtgccatcaagagaaacggaaaacaatcaatggagaagatattctcttt
gctatgtctactttaggctttgacagttatgtggaacctctgaaattataccttcagaaa
ttcagagaggctatgaaaggagaaaagggaattggtggagcagtcacagctacagatgga
ctaagtgaagagcttacagaggaggcatttactaaccagttaccagctggcttaataacc
acagacggtcaacaacaaaatgttatggtttacacaacatcatatcaacagatttctggt
gttcagcaaattcagttttcatga

DBGET integrated database retrieval system