KEGG   Homo sapiens (human): 4851Help
Entry
4851              CDS       T01001                                 

Gene name
NOTCH1, AOS5, AOVD1, TAN1, hN1
Definition
(RefSeq) notch receptor 1
  KO
K02599  Notch 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa05020  Prion diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H00002  T-cell acute lymphoblastic leukemia
H00031  Breast cancer
H00554  Bicuspid aortic valve
H01413  Adams-Oliver syndrome
Drug target
Brontictuzumab: D11229
Crenigacestat: D11151
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4851 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    4851 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4851 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4851 (NOTCH1)
   05206 MicroRNAs in cancer
    4851 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    4851 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    4851 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4851 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4851 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Notch Ank NOD DUF3454 NODP Ank_5 Ank_4 Ank_3 EGF_3
Motif
Other DBs
NCBI-GeneID: 4851
NCBI-ProteinID: NP_060087
OMIM: 190198
HGNC: 7881
Ensembl: ENSG00000148400
Vega: OTTHUMG00000020935
Pharos: P46531(Tchem)
UniProt: P46531
LinkDB All DBs
Structure
PDB: 

Position
9q34.3
AA seq 2555 aa AA seqDB search
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPA
NIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
NT seq 7668 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctcctggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggcccgcgatgctcccagcccggtgagacctgcctgaatggcgggaagtgtgaagcggcc
aatggcacggaggcctgcgtctgtggcggggccttcgtgggcccgcgatgccaggacccc
aacccgtgcctcagcaccccctgcaagaacgccgggacatgccacgtggtggaccgcaga
ggcgtggcagactatgcctgcagctgtgccctgggcttctctgggcccctctgcctgaca
cccctggacaatgcctgcctcaccaacccctgccgcaacgggggcacctgcgacctgctc
acgctgacggagtacaagtgccgctgcccgcccggctggtcagggaaatcgtgccagcag
gctgacccgtgcgcctccaacccctgcgccaacggtggccagtgcctgcccttcgaggcc
tcctacatctgccactgcccacccagcttccatggccccacctgccggcaggatgtcaac
gagtgtggccagaagcccgggctttgccgccacggaggcacctgccacaacgaggtcggc
tcctaccgctgcgtctgccgcgccacccacactggccccaactgcgagcggccctacgtg
ccctgcagcccctcgccctgccagaacgggggcacctgccgccccacgggcgacgtcacc
cacgagtgtgcctgcctgccaggcttcaccggccagaactgtgaggaaaatatcgacgat
tgtccaggaaacaactgcaagaacgggggtgcctgtgtggacggcgtgaacacctacaac
tgccgctgcccgccagagtggacaggtcagtactgtaccgaggatgtggacgagtgccag
ctgatgccaaatgcctgccagaacggcgggacctgccacaacacccacggtggctacaac
tgcgtgtgtgtcaacggctggactggtgaggactgcagcgagaacattgatgactgtgcc
agcgccgcctgcttccacggcgccacctgccatgaccgtgtggcctccttctactgcgag
tgtccccatggccgcacaggtctgctgtgccacctcaacgacgcatgcatcagcaacccc
tgtaacgagggctccaactgcgacaccaaccctgtcaatggcaaggccatctgcacctgc
ccctcggggtacacgggcccggcctgcagccaggacgtggatgagtgctcgctgggtgcc
aacccctgcgagcatgcgggcaagtgcatcaacacgctgggctccttcgagtgccagtgt
ctgcagggctacacgggcccccgatgcgagatcgacgtcaacgagtgcgtctcgaacccg
tgccagaacgacgccacctgcctggaccagattggggagttccagtgcatctgcatgccc
ggctacgagggtgtgcactgcgaggtcaacacagacgagtgtgccagcagcccctgcctg
cacaatggccgctgcctggacaagatcaatgagttccagtgcgagtgccccacgggcttc
actgggcatctgtgccagtacgatgtggacgagtgtgccagcaccccctgcaagaatggt
gccaagtgcctggacggacccaacacttacacctgtgtgtgcacggaagggtacacgggg
acgcactgcgaggtggacatcgatgagtgcgaccccgacccctgccactacggctcctgc
aaggacggcgtcgccaccttcacctgcctctgccgcccaggctacacgggccaccactgc
gagaccaacatcaacgagtgctccagccagccctgccgccacgggggcacctgccaggac
cgcgacaacgcctacctctgcttctgcctgaaggggaccacaggacccaactgcgagatc
aacctggatgactgtgccagcagcccctgcgactcgggcacctgtctggacaagatcgat
ggctacgagtgtgcctgtgagccgggctacacagggagcatgtgtaacatcaacatcgat
gagtgtgcgggcaacccctgccacaacgggggcacctgcgaggacggcatcaatggcttc
acctgccgctgccccgagggctaccacgaccccacctgcctgtctgaggtcaatgagtgc
aacagcaacccctgcgtccacggggcctgccgggacagcctcaacgggtacaagtgcgac
tgtgaccctgggtggagtgggaccaactgtgacatcaacaacaatgagtgtgaatccaac
ccttgtgtcaacggcggcacctgcaaagacatgaccagtggctacgtgtgcacctgccgg
gagggcttcagcggtcccaactgccagaccaacatcaacgagtgtgcgtccaacccatgt
ctgaaccagggcacgtgtattgacgacgttgccgggtacaagtgcaactgcctgctgccc
tacacaggtgccacgtgtgaggtggtgctggccccgtgtgcccccagcccctgcagaaac
ggcggggagtgcaggcaatccgaggactatgagagcttctcctgtgtctgccccacgggc
tggcaagggcagacctgtgaggtcgacatcaacgagtgcgttctgagcccgtgccggcac
ggcgcatcctgccagaacacccacggcggctaccgctgccactgccaggccggctacagt
gggcgcaactgcgagaccgacatcgacgactgccggcccaacccgtgtcacaacgggggc
tcctgcacagacggcatcaacacggccttctgcgactgcctgcccggcttccggggcact
ttctgtgaggaggacatcaacgagtgtgccagtgacccctgccgcaacggggccaactgc
acggactgcgtggacagctacacgtgcacctgccccgcaggcttcagcgggatccactgt
gagaacaacacgcctgactgcacagagagctcctgcttcaacggtggcacctgcgtggac
ggcatcaactcgttcacctgcctgtgtccacccggcttcacgggcagctactgccagcac
gatgtcaatgagtgcgactcacagccctgcctgcatggcggcacctgtcaggacggctgc
ggctcctacaggtgcacctgcccccagggctacactggccccaactgccagaaccttgtg
cactggtgtgactcctcgccctgcaagaacggcggcaaatgctggcagacccacacccag
taccgctgcgagtgccccagcggctggaccggcctttactgcgacgtgcccagcgtgtcc
tgtgaggtggctgcgcagcgacaaggtgttgacgttgcccgcctgtgccagcatggaggg
ctctgtgtggacgcgggcaacacgcaccactgccgctgccaggcgggctacacaggcagc
tactgtgaggacctggtggacgagtgctcacccagcccctgccagaacggggccacctgc
acggactacctgggcggctactcctgcaagtgcgtggccggctaccacggggtgaactgc
tctgaggagatcgacgagtgcctctcccacccctgccagaacgggggcacctgcctcgac
ctccccaacacctacaagtgctcctgcccacggggcactcagggtgtgcactgtgagatc
aacgtggacgactgcaatccccccgttgaccccgtgtcccggagccccaagtgctttaac
aacggcacctgcgtggaccaggtgggcggctacagctgcacctgcccgccgggcttcgtg
ggtgagcgctgtgagggggatgtcaacgagtgcctgtccaatccctgcgacgcccgtggc
acccagaactgcgtgcagcgcgtcaatgacttccactgcgagtgccgtgctggtcacacc
gggcgccgctgcgagtccgtcatcaatggctgcaaaggcaagccctgcaagaatgggggc
acctgcgccgtggcctccaacaccgcccgcgggttcatctgcaagtgccctgcgggcttc
gagggcgccacgtgtgagaatgacgctcgtacctgcggcagcctgcgctgcctcaacggc
ggcacatgcatctccggcccgcgcagccccacctgcctgtgcctgggccccttcacgggc
cccgaatgccagttcccggccagcagcccctgcctgggcggcaacccctgctacaaccag
gggacctgtgagcccacatccgagagccccttctaccgttgcctgtgccccgccaaattc
aacgggctcttgtgccacatcctggactacagcttcgggggtggggccgggcgcgacatc
cccccgccgctgatcgaggaggcgtgcgagctgcccgagtgccaggaggacgcgggcaac
aaggtctgcagcctgcagtgcaacaaccacgcgtgcggctgggacggcggtgactgctcc
ctcaacttcaatgacccctggaagaactgcacgcagtctctgcagtgctggaagtacttc
agtgacggccactgtgacagccagtgcaactcagccggctgcctcttcgacggctttgac
tgccagcgtgcggaaggccagtgcaaccccctgtacgaccagtactgcaaggaccacttc
agcgacgggcactgcgaccagggctgcaacagcgcggagtgcgagtgggacgggctggac
tgtgcggagcatgtacccgagaggctggcggccggcacgctggtggtggtggtgctgatg
ccgccggagcagctgcgcaacagctccttccacttcctgcgggagctcagccgcgtgctg
cacaccaacgtggtcttcaagcgtgacgcacacggccagcagatgatcttcccctactac
ggccgcgaggaggagctgcgcaagcaccccatcaagcgtgccgccgagggctgggccgca
cctgacgccctgctgggccaggtgaaggcctcgctgctccctggtggcagcgagggtggg
cggcggcggagggagctggaccccatggacgtccgcggctccatcgtctacctggagatt
gacaaccggcagtgtgtgcaggcctcctcgcagtgcttccagagtgccaccgacgtggcc
gcattcctgggagcgctcgcctcgctgggcagcctcaacatcccctacaagatcgaggcc
gtgcagagtgagaccgtggagccgcccccgccggcgcagctgcacttcatgtacgtggcg
gcggccgcctttgtgcttctgttcttcgtgggctgcggggtgctgctgtcccgcaagcgc
cggcggcagcatggccagctctggttccctgagggcttcaaagtgtctgaggccagcaag
aagaagcggcgggagcccctcggcgaggactccgtgggcctcaagcccctgaagaacgct
tcagacggtgccctcatggacgacaaccagaatgagtggggggacgaggacctggagacc
aagaagttccggttcgaggagcccgtggttctgcctgacctggacgaccagacagaccac
cggcagtggactcagcagcacctggatgccgctgacctgcgcatgtctgccatggccccc
acaccgccccagggtgaggttgacgccgactgcatggacgtcaatgtccgcgggcctgat
ggcttcaccccgctcatgatcgcctcctgcagcgggggcggcctggagacgggcaacagc
gaggaagaggaggacgcgccggccgtcatctccgacttcatctaccagggcgccagcctg
cacaaccagacagaccgcacgggcgagaccgccttgcacctggccgcccgctactcacgc
tctgatgccgccaagcgcctgctggaggccagcgcagatgccaacatccaggacaacatg
ggccgcaccccgctgcatgcggctgtgtctgccgacgcacaaggtgtcttccagatcctg
atccggaaccgagccacagacctggatgcccgcatgcatgatggcacgacgccactgatc
ctggctgcccgcctggccgtggagggcatgctggaggacctcatcaactcacacgccgac
gtcaacgccgtagatgacctgggcaagtccgccctgcactgggccgccgccgtgaacaat
gtggatgccgcagttgtgctcctgaagaacggggctaacaaagatatgcagaacaacagg
gaggagacacccctgtttctggccgcccgggagggcagctacgagaccgccaaggtgctg
ctggaccactttgccaaccgggacatcacggatcatatggaccgcctgccgcgcgacatc
gcacaggagcgcatgcatcacgacatcgtgaggctgctggacgagtacaacctggtgcgc
agcccgcagctgcacggagccccgctggggggcacgcccaccctgtcgcccccgctctgc
tcgcccaacggctacctgggcagcctcaagcccggcgtgcagggcaagaaggtccgcaag
cccagcagcaaaggcctggcctgtggaagcaaggaggccaaggacctcaaggcacggagg
aagaagtcccaggacggcaagggctgcctgctggacagctccggcatgctctcgcccgtg
gactccctggagtcaccccatggctacctgtcagacgtggcctcgccgccactgctgccc
tccccgttccagcagtctccgtccgtgcccctcaaccacctgcctgggatgcccgacacc
cacctgggcatcgggcacctgaacgtggcggccaagcccgagatggcggcgctgggtggg
ggcggccggctggcctttgagactggcccacctcgtctctcccacctgcctgtggcctct
ggcaccagcaccgtcctgggctccagcagcggaggggccctgaatttcactgtgggcggg
tccaccagtttgaatggtcaatgcgagtggctgtcccggctgcagagcggcatggtgccg
aaccaatacaaccctctgcgggggagtgtggcaccaggccccctgagcacacaggccccc
tccctgcagcatggcatggtaggcccgctgcacagtagccttgctgccagcgccctgtcc
cagatgatgagctaccagggcctgcccagcacccggctggccacccagcctcacctggtg
cagacccagcaggtgcagccacaaaacttacagatgcagcagcagaacctgcagccagca
aacatccagcagcagcaaagcctgcagccgccaccaccaccaccacagccgcaccttggc
gtgagctcagcagccagcggccacctgggccggagcttcctgagtggagagccgagccag
gcagacgtgcagccactgggccccagcagcctggcggtgcacactattctgccccaggag
agccccgccctgcccacgtcgctgccatcctcgctggtcccacccgtgaccgcagcccag
ttcctgacgcccccctcgcagcacagctactcctcgcctgtggacaacacccccagccac
cagctacaggtgcctgagcaccccttcctcaccccgtcccctgagtcccctgaccagtgg
tccagctcgtccccgcattccaacgtctccgactggtccgagggcgtctccagccctccc
accagcatgcagtcccagatcgcccgcattccggaggccttcaagtaa

KEGG   Homo sapiens (human): 4853Help
Entry
4853              CDS       T01001                                 

Gene name
NOTCH2, AGS2, HJCYS, hN2
Definition
(RefSeq) notch receptor 2
  KO
K20994  Notch 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H00409  Type 2 diabetes mellitus
H00551  Alagille syndrome
H00623  Hajdu-Cheney syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4853 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    4853 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4853 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4853 (NOTCH2)
   05206 MicroRNAs in cancer
    4853 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    4853 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4853 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4853 (NOTCH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA DUF3454 NOD Notch EGF_2 Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 4853
NCBI-ProteinID: NP_077719
OMIM: 600275
HGNC: 7882
Ensembl: ENSG00000134250
Vega: OTTHUMG00000012177
Pharos: Q04721(Tchem)
UniProt: Q04721 Q9UFD5 Q6IQ50
LinkDB All DBs
Structure
PDB: 

Position
1p12
AA seq 2471 aa AA seqDB search
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctctgctgtgggcgctgctggcgctctggctgtgctgcgcg
gcccccgcgcatgcattgcagtgtcgagatggctatgaaccctgtgtaaatgaaggaatg
tgtgttacctaccacaatggcacaggatactgcaaatgtccagaaggcttcttgggggaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagccacgtgccgatgtgcctcagggtttacaggagaggac
tgccagtactcaacatctcatccatgctttgtgtctcgaccctgcctgaatggcggcaca
tgccatatgctcagccgggatacctatgagtgcacctgtcaagtcgggtttacaggtaag
gagtgccaatggacggatgcctgcctgtctcatccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcaaatgcctcacaggcttcacagggcagaaatgtgag
actgatgtcaatgagtgtgacattccaggacactgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggcttcacaggccagtactgtgacagc
ctgtatgtgccctgtgcaccctcaccttgtgtcaatggaggcacctgtcggcagactggt
gacttcacttttgagtgcaactgccttccaggttttgaagggagcacctgtgagaggaat
attgatgactgccctaaccacaggtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgtcccccacaatggacaggacagttctgcacagaggatgtggat
gaatgcctgctgcagcccaatgcctgtcaaaatgggggcacctgtgccaaccgcaatgga
ggctatggctgtgtatgtgtcaacggctggagtggagatgactgcagtgagaacattgat
gattgtgccttcgcctcctgtactccaggctccacctgcatcgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctaaatgggcaatatatt
tgcacctgcccacaaggctacaaaggggctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaacacggatggcgccttc
cactgtgagtgtctgaagggttatgcaggacctcgttgtgagatggacatcaatgagtgc
cattcagacccctgccagaatgatgctacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattagaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgtttccagtgcctgtgt
cctcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggtcagtgtcaggatggtattgattcctacacctgcatctgcaatcccgggtacatg
ggcgccatctgcagtgaccagattgatgaatgttacagcagcccttgcctgaacgatggt
cgctgcattgacctggtcaatggctaccagtgcaactgccagccaggcacgtcaggggtt
aattgtgaaattaattttgatgactgtgcaagtaacccttgtatccatggaatctgtatg
gatggcattaatcgctacagttgtgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaacggt
gtgaatggtttccgctgtatatgccccgagggaccccatcaccccagctgctactcacag
gtgaacgaatgcctgagcaatccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgtctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgcctttcgaatccatgccagaatggaggaacttgtgacaatctggtgaatggatacagg
tgtacttgcaagaagggctttaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagacagtattggctccctgttccccaaac
ccttgtgagaatgctgctgtttgcaaagagtcaccaaattttgagagttatacttgcttg
tgtgctcctggctggcaaggtcagcggtgtaccattgacattgacgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggcagctacatgtgtgaatgtcca
ccaggcttcagtggtatggactgtgaggaggacattgatgactgccttgccaatccttgc
cagaatggaggttcctgtatggatggagtgaatactttctcctgcctctgccttccgggt
ttcactggggataagtgccagacagacatgaatgagtgtctgagtgaaccctgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccattgtgagaacaacatcaatgagtgcactgagagctcctgtttcaatggtggc
acatgtgttgatgggattaactccttctcttgcttgtgccctgtgggtttcactggatcc
ttctgcctccatgagatcaatgaatgcagctctcatccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgcagctgccccctgggctacactgggaaaaactgt
cagaccctggtgaatctctgcagtcggtctccatgtaaaaacaaaggtacttgcgttcag
aaaaaagcagagtcccagtgcctatgtccatctggatgggctggtgcctattgtgacgtg
cccaatgtctcttgtgacatagcagcctccaggagaggtgtgcttgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgccccctgggc
tatactgggagctactgtgaggagcaactcgatgagtgtgcgtccaacccctgccagcac
ggggcaacatgcagtgacttcattggtggatacagatgcgagtgtgtcccaggctatcag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcttgcccaccaggcactcggggccta
ctctgtgaagagaacattgatgactgtgcccggggtccccattgccttaatggtggtcag
tgcatggataggattggaggctacagttgtcgctgcttgcctggctttgctggggagcgt
tgtgagggagacatcaacgagtgcctctccaacccctgcagctctgagggcagcctggac
tgtatacagctcaccaatgactacctgtgtgtttgccgtagtgcctttactggccggcac
tgtgaaaccttcgtcgatgtgtgtccccagatgccctgcctgaatggagggacttgtgct
gtggccagtaacatgcctgatggtttcatttgccgttgtcccccgggattttccggggca
aggtgccagagcagctgtggacaagtgaaatgtaggaagggggagcagtgtgtgcacacc
gcctctggaccccgctgcttctgccccagtccccgggactgcgagtcaggctgtgccagt
agcccctgccagcacgggggcagctgccaccctcagcgccagcctccttattactcctgc
cagtgtgccccaccattctcgggtagccgctgtgaactctacacggcaccccccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcgtctgtgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttctctcaccatggag
aacccctgggccaactgctcctccccacttccctgctgggattatatcaacaaccagtgt
gatgagctgtgcaacacggtcgagtgcctgtttgacaactttgaatgccaggggaacagc
aagacatgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
gggtgcaacagtgaggagtgtggttgggatgggctggactgtgctgctgaccaacctgag
aacctggcagaaggtaccctggttattgtggtattgatgccacctgaacaactgctccag
gatgctcgcagcttcttgcgggcactgggtaccctgctccacaccaacctgcgcattaag
cgggactcccagggggaactcatggtgtacccctattatggtgagaagtcagctgctatg
aagaaacagaggatgacacgcagatcccttcctggtgaacaagaacaggaggtggctggc
tctaaagtctttctggaaattgacaaccgccagtgtgttcaagactcagaccactgcttc
aagaacacggatgcagcagcagctctcctggcctctcacgccatacaggggaccctgtca
taccctcttgtgtctgtcgtcagtgaatccctgactccagaacgcactcagctcctctat
ctccttgctgttgctgttgtcatcattctgtttattattctgctgggggtaatcatggca
aaacgaaagcgtaagcatggctctctctggctgcctgaaggtttcactcttcgccgagat
gcaagcaatcacaagcgtcgtgagccagtgggacaggatgctgtggggctgaaaaatctc
tcagtgcaagtctcagaagctaacctaattggtactggaacaagtgaacactgggtcgat
gatgaagggccccagccaaagaaagtaaaggctgaagatgaggccttactctcagaagaa
gatgaccccattgatcgacggccatggacacagcagcaccttgaagctgcagacatccgt
aggacaccatcgctggctctcacccctcctcaggcagagcaggaggtggatgtgttagat
gtgaatgtccgtggcccagatggctgcaccccattgatgttggcttctctccgaggaggc
agctcagatttgagtgatgaagatgaagatgcagaggactcttctgctaacatcatcaca
gacttggtctaccagggtgccagcctccaggcccagacagaccggactggtgagatggcc
ctgcaccttgcagcccgctactcacgggctgatgctgccaagcgtctcctggatgcaggt
gcagatgccaatgcccaggacaacatgggccgctgtccactccatgctgcagtggcagct
gatgcccaaggtgtcttccagattctgattcgcaaccgagtaactgatctagatgccagg
atgaatgatggtactacacccctgatcctggctgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcggatgtgaatgcagtggatgaccatggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcaactcttttgttgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacacctctgtttcttgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgagacatcacagac
catatggatcgtcttccccgggatgtggctcgggatcgcatgcaccatgacattgtgcgc
cttctggatgaatacaatgtgaccccaagccctccaggcaccgtgttgacttctgctctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctgaagcacaccccaatgggc
aagaagtctagacggcccagtgccaagagtaccatgcctactagcctccctaaccttgcc
aaggaggcaaaggatgccaagggtagtaggaggaagaagtctctgagtgagaaggtccaa
ctgtctgagagttcagtaactttatcccctgttgattccctagaatctcctcacacgtat
gtttccgacaccacatcctctccaatgattacatcccctgggatcttacaggcctcaccc
aaccctatgttggccactgccgcccctcctgccccagtccatgcccagcatgcactatct
ttttctaaccttcatgaaatgcagcctttggcacatggggccagcactgtgcttccctca
gtgagccagttgctatcccaccaccacattgtgtctccaggcagtggcagtgctggaagc
ttgagtaggctccatccagtcccagtcccagcagattggatgaaccgcatggaggtgaat
gagacccagtacaatgagatgtttggtatggtcctggctccagctgagggcacccatcct
ggcatagctccccagagcaggccacctgaagggaagcacataaccacccctcgggagccc
ttgccccccattgtgactttccagctcatccctaaaggcagtattgcccaaccagcgggg
gctccccagcctcagtccacctgccctccagctgttgcgggccccctgcccaccatgtac
cagattccagaaatggcccgtttgcccagtgtggctttccccactgccatgatgccccag
caggacgggcaggtagctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggcaagtaccccacacccccttcacagcacagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggaggtcagcggggacctgggacacacatgtct
gagccaccacacaacaacatgcaggtttatgcgtga

KEGG   Homo sapiens (human): 4854Help
Entry
4854              CDS       T01001                                 

Gene name
NOTCH3, CADASIL, CADASIL1, CASIL, IMF2, LMNS
Definition
(RefSeq) notch receptor 3
  KO
K20995  Notch 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04371  Apelin signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H00536  Cerebral autosomal dominant arteriopathy with subcortical infarcts and leucoencephalopathy (CADASIL)
H01893  Lateral meningocele syndrome
H01910  Infantile myofibromatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4854 (NOTCH3)
   04371 Apelin signaling pathway
    4854 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    4854 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4854 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4854 (NOTCH3)
   05206 MicroRNAs in cancer
    4854 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    4854 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4854 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4854 (NOTCH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank Ank_2 Ank_5 NODP NOD DUF3454 Ank_3 Ank_4 cEGF EGF_3 FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 4854
NCBI-ProteinID: NP_000426
OMIM: 600276
HGNC: 7883
Ensembl: ENSG00000074181
Vega: OTTHUMG00000183217
Pharos: Q9UM47(Tchem)
UniProt: Q9UM47
LinkDB All DBs
Structure
PDB: 

Position
19p13.12
AA seq 2321 aa AA seqDB search
MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
NT seq 6966 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggggcccgtggccgccgccgccgccgtcgcccgatgtcgccgccaccgcca
ccgccacccgtgcgggcgctgcccctgctgctgctgctagcggggccgggggctgcagcc
cccccttgcctggacggaagcccgtgtgcaaatggaggtcgttgcacccagctgccctcc
cgggaggctgcctgcctgtgcccgcctggctgggtgggtgagcggtgtcagctggaggac
ccctgtcactcaggcccctgtgctggccgtggtgtctgccagagttcagtggtggctggc
accgcccgattctcatgccggtgcccccgtggcttccgaggccctgactgctccctgcca
gatccctgcctcagcagcccttgtgcccacggtgcccgctgctcagtggggcccgatgga
cgcttcctctgctcctgcccacctggctaccagggccgcagctgccgaagcgacgtggat
gagtgccgggtgggtgagccctgccgccatggtggcacctgcctcaacacacctggctcc
ttccgctgccagtgtccagctggctacacagggccactatgtgagaaccccgcggtgccc
tgtgcaccctcaccatgccgtaacgggggcacctgcaggcagagtggcgacctcacttac
gactgtgcctgtcttcctgggtttgagggtcagaattgtgaagtgaacgtggacgactgt
ccaggacaccgatgtctcaatggggggacatgcgtggatggcgtcaacacctataactgc
cagtgccctcctgagtggacaggccagttctgcacggaggacgtggatgagtgtcagctg
cagcccaacgcctgccacaatgggggtacctgcttcaacacgctgggtggccacagctgc
gtgtgtgtcaatggctggacaggcgagagctgcagtcagaatatcgatgactgtgccaca
gccgtgtgcttccatggggccacctgccatgaccgcgtggcttctttctactgtgcctgc
cccatgggcaagactggcctcctgtgtcacctggatgacgcctgtgtcagcaacccctgc
cacgaggatgctatctgtgacacaaatccggtgaacggccgggccatttgcacctgtcct
cccggcttcacgggtggggcatgtgaccaggatgtggacgagtgctctatcggcgccaac
ccctgcgagcacttgggcaggtgcgtgaacacgcagggctccttcctgtgccagtgcggt
cgtggctacactggacctcgctgtgagaccgatgtcaacgagtgtctgtcggggccctgc
cgaaaccaggccacgtgcctcgaccgcataggccagttcacctgtatctgtatggcaggc
ttcacaggaacctattgcgaggtggacattgacgagtgtcagagtagcccctgtgtcaac
ggtggggtctgcaaggaccgagtcaatggcttcagctgcacctgcccctcgggcttcagc
ggctccacgtgtcagctggacgtggacgaatgcgccagcacgccctgcaggaatggcgcc
aaatgcgtggaccagcccgatggctacgagtgccgctgtgccgagggctttgagggcacg
ctgtgtgatcgcaacgtggacgactgctcccctgacccatgccaccatggtcgctgcgtg
gatggcatcgccagcttctcatgtgcctgtgctcctggctacacgggcacacgctgcgag
agccaggtggacgaatgccgcagccagccctgccgccatggcggcaaatgcctagacctg
gtggacaagtacctctgccgctgcccttctgggaccacaggtgtgaactgcgaagtgaac
attgacgactgtgccagcaacccctgcacctttggagtctgccgtgatggcatcaaccgc
tacgactgtgtctgccaacctggcttcacagggcccctttgtaacgtggagatcaatgag
tgtgcttccagcccatgcggcgagggaggttcctgtgtggatggggaaaatggcttccgc
tgcctctgcccgcctggctccttgcccccactctgcctccccccgagccatccctgtgcc
catgagccctgcagtcacggcatctgctatgatgcacctggcgggttccgctgtgtgtgt
gagcctggctggagtggcccccgctgcagccagagcctggcccgagacgcctgtgagtcc
cagccgtgcagggccggtgggacatgcagcagcgatggaatgggtttccactgcacctgc
ccgcctggtgtccagggacgtcagtgtgaactcctctccccctgcaccccgaacccctgt
gagcatgggggccgctgcgagtctgcccctggccagctgcctgtctgctcctgcccccag
ggctggcaaggcccacgatgccagcaggatgtggacgagtgtgctggccccgcaccctgt
ggccctcatggtatctgcaccaacctggcagggagtttcagctgcacctgccatggaggg
tacactggcccttcctgcgatcaggacatcaatgactgtgaccccaacccatgcctgaac
ggtggctcgtgccaagacggcgtgggctccttttcctgctcctgcctccctggtttcgcc
ggcccacgatgcgcccgcgatgtggatgagtgcctgagcaacccctgcggcccgggcacc
tgtaccgaccacgtggcctccttcacctgcacctgcccgccaggctacggaggcttccac
tgcgaacaggacctgcccgactgcagccccagctcctgcttcaatggcgggacctgtgtg
gacggcgtgaactcgttcagctgcctgtgccgtcccggctacacaggagcccactgccaa
catgaggcagacccctgcctctcgcggccctgcctacacgggggcgtctgcagcgccgcc
caccctggcttccgctgcacctgcctcgagagcttcacgggcccgcagtgccagacgctg
gtggattggtgcagccgccagccttgtcaaaacgggggtcgctgcgtccagactggggcc
tattgcctttgtccccctggatggagcggacgcctctgtgacatccgaagcttgccctgc
agggaggccgcagcccagatcggggtgcggctggagcagctgtgtcaggcgggtgggcag
tgtgtggatgaagacagctcccactactgcgtgtgcccagagggccgtactggtagccac
tgtgagcaggaggtggacccctgcttggcccagccctgccagcatggggggacctgccgt
ggctatatggggggctacatgtgtgagtgtcttcctggctacaatggtgataactgtgag
gacgacgtggacgagtgtgcctcccagccctgccagcacgggggttcatgcattgacctc
gtggcccgctatctctgctcctgtcccccaggaacgctgggggtgctctgcgagattaat
gaggatgactgcggcccaggcccaccgctggactcagggccccggtgcctacacaatggc
acctgcgtggacctggtgggtggtttccgctgcacctgtcccccaggatacactggtttg
cgctgcgaggcagacatcaatgagtgtcgctcaggtgcctgccacgcggcacacacccgg
gactgcctgcaggacccaggcggaggtttccgttgcctttgtcatgctggcttctcaggt
cctcgctgtcagactgtcctgtctccctgcgagtcccagccatgccagcatggaggccag
tgccgtcctagcccgggtcctgggggtgggctgaccttcacctgtcactgtgcccagccg
ttctggggtccgcgttgcgagcgggtggcgcgctcctgccgggagctgcagtgcccggtg
ggcgtcccatgccagcagacgccccgcgggccgcgctgcgcctgccccccagggttgtcg
ggaccctcctgccgcagcttcccggggtcgccgccgggggccagcaacgccagctgcgcg
gccgccccctgtctccacgggggctcctgccgccccgcgccgctcgcgcccttcttccgc
tgcgcttgcgcgcagggctggaccgggccgcgctgcgaggcgcccgccgcggcacccgag
gtctcggaggagccgcggtgcccgcgcgccgcctgccaggccaagcgcggggaccagcgc
tgcgaccgcgagtgcaacagcccaggctgcggctgggacggcggcgactgctcgctgagc
gtgggcgacccctggcggcaatgcgaggcgctgcagtgctggcgcctcttcaacaacagc
cgctgcgaccccgcctgcagctcgcccgcctgcctctacgacaacttcgactgccacgcc
ggtggccgcgagcgcacttgcaacccggtgtacgagaagtactgcgccgaccactttgcc
gacggccgctgcgaccagggctgcaacacggaggagtgcggctgggatgggctggattgt
gccagcgaggtgccggccctgctggcccgcggcgtgctggtgctcacagtgctgctgccg
ccagaggagctactgcgttccagcgccgactttctgcagcggctcagcgccatcctgcgc
acctcgctgcgcttccgcctggacgcgcacggccaggccatggtcttcccttaccaccgg
cctagtcctggctccgaaccccgggcccgtcgggagctggcccccgaggtgatcggctcg
gtagtaatgctggagattgacaaccggctctgcctgcagtcgcctgagaatgatcactgc
ttccccgatgcccagagcgccgctgactacctgggagcgttgtcagcggtggagcgcctg
gacttcccgtacccactgcgggacgtgcggggggagccgctggagcctccagaacccagc
gtcccgctgctgccactgctagtggcgggcgctgtcttgctgctggtcattctcgtcctg
ggtgtcatggtggcccggcgcaagcgcgagcacagcaccctctggttccctgagggcttc
tcactgcacaaggacgtggcctctggtcacaagggccggcgggaacccgtgggccaggac
gcgctgggcatgaagaacatggccaagggtgagagcctgatgggggaggtggccacagac
tggatggacacagagtgcccagaggccaagcggctaaaggtagaggagccaggcatgggg
gctgaggaggctgtggattgccgtcagtggactcaacaccatctggttgctgctgacatc
cgcgtggcaccagccatggcactgacaccaccacagggcgacgcagatgctgatggcatg
gatgtcaatgtgcgtggcccagatggcttcaccccgctaatgctggcttccttctgtggg
ggggctctggagccaatgccaactgaagaggatgaggcagatgacacatcagctagcatc
atctccgacctgatctgccagggggctcagcttggggcacggactgaccgtactggcgag
actgctttgcacctggctgcccgttatgcccgtgctgatgcagccaagcggctgctggat
gctggggcagacaccaatgcccaggaccactcaggccgcactcccctgcacacagctgtc
acagccgatgcccagggtgtcttccagattctcatccgaaaccgctctacagacttggat
gcccgcatggcagatggctcaacggcactgatcctggcggcccgcctggcagtagagggc
atggtggaagagctcatcgccagccatgctgatgtcaatgctgtggatgagcttgggaaa
tcagccttacactgggctgcggctgtgaacaacgtggaagccactttggccctgctcaaa
aatggagccaataaggacatgcaggatagcaaggaggagacccccctattcctggccgcc
cgcgagggcagctatgaggctgccaagctgctgttggaccactttgccaaccgtgagatc
accgaccacctggacaggctgccgcgggacgtagcccaggagagactgcaccaggacatc
gtgcgcttgctggatcaacccagtgggccccgcagcccccccggtccccacggcctgggg
cctctgctctgtcctccaggggccttcctccctggcctcaaagcggcacagtcggggtcc
aagaagagcaggaggccccccgggaaggcggggctggggccgcaggggccccgggggcgg
ggcaagaagctgacgctggcctgcccgggccccctggctgacagctcggtcacgctgtcg
cccgtggactcgctggactccccgcggcctttcggtgggccccctgcttcccctggtggc
ttcccccttgaggggccctatgcagctgccactgccactgcagtgtctctggcacagctt
ggtggcccaggccgggcgggtctagggcgccagccccctggaggatgtgtactcagcctg
ggcctgctgaaccctgtggctgtgcccctcgattgggcccggctgcccccacctgcccct
ccaggcccctcgttcctgctgccactggcgccgggaccccagctgctcaacccagggacc
cccgtctccccgcaggagcggcccccgccttacctggcagtcccaggacatggcgaggag
tacccggcggctggggcacacagcagccccccaaaggcccgcttcctgcgggttcccagt
gagcacccttacctgaccccatcccccgaatcccctgagcactgggccagcccctcacct
ccctccctctcagactggtccgaatccacgcctagcccagccactgccactggggccatg
gccaccaccactggggcactgcctgcccagccacttcccttgtctgttcccagctccctt
gctcaggcccagacccagctggggccccagccggaagttacccccaagaggcaagtgttg
gcctga

KEGG   Homo sapiens (human): 4855Help
Entry
4855              CDS       T01001                                 

Gene name
NOTCH4, INT3
Definition
(RefSeq) notch receptor 4
  KO
K20996  Notch 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H00031  Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4855 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4855 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4855 (NOTCH4)
   05206 MicroRNAs in cancer
    4855 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    4855 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4855 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4855 (NOTCH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank Ank_5 Notch Ank_3 Ank_4 NODP EGF_2 NOD cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 4855
NCBI-ProteinID: NP_004548
OMIM: 164951
HGNC: 7884
Ensembl: ENSG00000204301
Vega: OTTHUMG00000031044
Pharos: Q99466(Tchem)
UniProt: Q99466 A0A1U9X983
LinkDB All DBs
Position
6p21.32
AA seq 2003 aa AA seqDB search
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgctgctgctgctatgtgtctcagtg
gtcagacccagagggctgctgtgtgggagtttcccagaaccctgtgccaatggaggcacc
tgcctgagcctgtctctgggacaagggacctgccagtgtgcccctggcttcctgggtgag
acgtgccagtttcctgacccctgccagaacgcccagctctgccaaaatggaggcagctgc
caagccctgcttcccgctcccctagggctccccagctctccctctccattgacacccagc
ttcttgtgcacttgcctccctggcttcactggtgagagatgccaggccaagcttgaagac
ccttgtcctccctccttctgttccaaaaggggccgctgccacatccaggcctcgggccgc
ccacagtgctcctgcatgcctggatggacaggtgagcagtgccagcttcgggacttctgt
tcagccaacccatgtgttaatggaggggtgtgtctggccacatacccccagatccagtgc
cactgcccaccgggcttcgagggccatgcctgtgaacgtgatgtcaacgagtgcttccag
gacccaggaccctgccccaaaggcacctcctgccataacaccctgggctccttccagtgc
ctctgccctgtggggcaggagggtccacgttgtgagctgcgggcaggaccctgccctcct
aggggctgttcgaatgggggcacctgccagctgatgccagagaaagactccacctttcac
ctctgcctctgtcccccaggtttcataggcccagactgtgaggtgaatccagacaactgt
gtcagccaccagtgtcagaatgggggcacttgccaggatgggctggacacctacacctgc
ctctgcccagaaacctggacaggctgggactgctccgaagatgtggatgagtgtgagacc
cagggtccccctcactgcagaaacgggggcacctgccagaactctgctggtagctttcac
tgcgtgtgtgtgagtggctggggcggcacaagctgtgaggagaacctggatgactgtatt
gctgccacctgtgccccgggatccacctgcattgaccgggtgggctctttctcctgcctc
tgcccacctggacgcacaggactcctgtgccacttggaagacatgtgtctgagccagccg
tgccatggggatgcccaatgcagcaccaaccccctcacaggctccacactctgcctgtgt
cagcctggctattcggggcccacctgccaccaggacctggacgagtgtctgatggcccag
caaggcccaagtccctgtgaacatggcggttcctgcctcaacactcctggctccttcaac
tgcctctgtccacctggctacacaggctcccgttgtgaggctgatcacaatgagtgcctc
tcccagccctgccacccaggaagcacctgtctggacctacttgccaccttccactgcctc
tgcccgccaggcttagaagggcagctctgtgaggtggagaccaacgagtgtgcctcagct
ccctgcctgaaccacgcggattgccatgacctgctcaacggcttccagtgcatctgcctg
cctggattctccggcacccgatgtgaggaggatatcgatgagtgcagaagctctccctgt
gccaatggtgggcagtgccaggaccagcctggagccttccactgcaagtgtctcccaggc
tttgaagggccacgctgtcaaacagaggtggatgagtgcctgagtgacccatgtcccgtt
ggagccagctgccttgatcttccaggagccttcttttgcctctgcccctctggtttcaca
ggccagctctgtgaggttcccctgtgtgctcccaacctgtgccagcccaagcagatatgt
aaggaccagaaagacaaggccaactgcctctgtcctgatggaagccctggctgtgcccca
cctgaggacaactgcacctgccaccacgggcactgccagagatcctcatgtgtgtgtgac
gtgggttggacggggccagagtgtgaggcagagctagggggctgcatctctgcaccctgt
gcccatggggggacctgctacccccagccctctggctacaactgcacctgccctacaggc
tacacaggacccacctgtagtgaggagatgacagcttgtcactcagggccatgtctcaat
ggcggctcctgcaaccctagccctggaggctactactgcacctgccctccaagccacaca
gggccccagtgccaaaccagcactgactactgtgtgtctgccccgtgcttcaatgggggt
acctgtgtgaacaggcctggcaccttctcctgcctctgtgccatgggcttccagggcccg
cgctgtgagggaaagctccgccccagctgtgcagacagcccctgtaggaatagggcaacc
tgccaggacagccctcagggtccccgctgcctctgccccactggctacaccggaggcagc
tgccagactctgatggacttatgtgcccagaagccctgcccacgcaattcccactgcctc
cagactgggccctccttccactgcttgtgcctccagggatggaccgggcctctctgcaac
cttccactgtcctcctgccagaaggctgcactgagccaaggcatagacgtctcttccctt
tgccacaatggaggcctctgtgtcgacagcggcccctcctatttctgccactgcccccct
ggattccaaggcagcctgtgccaggatcacgtgaacccatgtgagtccaggccttgccag
aacggggccacctgcatggcccagcccagtgggtatctctgccagtgtgccccaggctac
gatggacagaactgctcaaaggaactcgatgcttgtcagtcccaaccctgtcacaaccat
ggaacctgtactcccaaacctggaggattccactgtgcctgccctccaggctttgtgggg
ctacgctgtgagggagacgtggacgagtgtctggaccagccctgccaccccacaggcact
gcagcctgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggc
cagtggtgtgaggtggagatagacccctgccacagccaaccctgctttcatggagggacc
tgtgaggccacagcaggatcacccctgggtttcatctgccactgccccaagggttttgaa
ggccccacctgcagccacagggccccttcctgcggcttccatcactgccaccacggaggc
ctgtgtctgccctcccctaagccaggcttcccaccacgctgtgcctgcctcagtggctat
gggggtcctgactgcctgaccccaccagctcctaaaggctgtggccctccctccccatgc
ctatacaatggcagctgctcagagaccacgggcttggggggcccaggctttcgatgctcc
tgccctcacagctctccagggccccggtgtcagaaacccggagccaaggggtgtgagggc
agaagtggagatggggcctgcgatgctggctgcagtggcccgggaggaaactgggatgga
ggggactgctctctgggagtcccagacccctggaagggctgcccctcccactctcggtgc
tggcttctcttccgggacgggcagtgccacccacagtgtgactctgaagagtgtctgttt
gatggctacgactgtgagacccctccagcctgcactccagcctatgaccagtactgccat
gatcacttccacaacgggcactgtgagaaaggctgcaacactgcagagtgtggctgggat
ggaggtgactgcaggcctgaagatggggacccagagtgggggccctccctggccctgctg
gtggtactgagccccccagccctagaccagcagctgtttgccctggcccgggtgctgtcc
ctgactctgagggtaggactctgggtaaggaaggatcgtgatggcagggacatggtgtac
ccctatcctggggcccgggctgaagaaaagctaggaggaactcgggaccccacctatcag
gagagagcagcccctcaaacgcagcccctgggcaaggagaccgactccctcagtgctggg
tttgtggtggtcatgggtgtggatttgtcccgctgtggccctgaccacccggcatcccgc
tgtccctgggaccctgggcttctactccgcttccttgctgcgatggctgcagtgggagcc
ctggagcccctgctgcctggaccactgctggctgtccaccctcatgcagggaccgcaccc
cctgccaaccagcttccctggcctgtgctgtgctccccagtggccggggtgattctcctg
gccctaggggctcttctcgtcctccagctcatccggcgtcgacgccgagagcatggagct
ctctggctgccccctggtttcactcgacggcctcggactcagtcagctccccaccgacgc
cggcccccactaggcgaggacagcattggtctcaaggcactgaagccaaaggcagaagtt
gatgaggatggagttgtgatgtgctcaggccctgaggagggagaggaggtgggccaggct
gaagaaacaggcccaccctccacgtgccagctctggtctctgagtggtggctgtggggcg
ctccctcaggcagccatgctaactcctccccaggaatctgagatggaagcccctgacctg
gacacccgtggacctgatggggtgacacccctgatgtcagcagtttgctgtggggaagta
cagtccgggaccttccaaggggcatggttgggatgtcctgagccctgggaacctctgctg
gatggaggggcctgtccccaggctcacaccgtgggcactggggagacccccctgcacctg
gctgcccgattctcccggccaaccgctgcccgccgcctccttgaggctggagccaacccc
aaccagccagaccgggcagggcgcacaccccttcatgctgctgtggctgctgatgctcgg
gaggtctgccagcttctgctccgtagcagacaaactgcagtggacgctcgcacagaggac
gggaccacacccttgatgctggctgccaggctggcggtggaagacctggttgaagaactg
attgcagcccaagcagacgtgggggccagagataaatgggggaaaactgcgctgcactgg
gctgctgccgtgaacaacgcccgagccgcccgctcgcttctccaggccggagccgataaa
gatgcccaggacaacagggagcagacgccgctattcctggcggcgcgggaaggagcggtg
gaagtagcccagctactgctggggctgggggcagcccgagagctgcgggaccaggctggg
ctagcgccggcggacgtcgctcaccaacgtaaccactgggatctgctgacgctgctggaa
ggggctgggccaccagaggcccgtcacaaagccacgccgggccgcgaggctgggcccttc
ccgcgcgcacggacggtgtcagtaagcgtgcccccgcatgggggcggggctctgccgcgc
tgccggacgctgtcagccggagcaggccctcgtgggggcggagcttgtctgcaggctcgg
acttggtccgtagacttggctgcgcgggggggcggggcctattctcattgccggagcctc
tcgggagtaggagcaggaggaggcccgacccctcgcggccgtaggttttctgcaggcatg
cgcgggcctcggcccaaccctgcgataatgcgaggaagatacggagtggctgccgggcgc
ggaggcagggtctcaacggatgactggccctgtgattgggtggccctgggagcttgcggt
tctgcctccaacattccgatcccgcctccttgccttactccgtccccggagcggggatca
cctcaacttgactgtggtcccccagccctccaagaaatgcccataaaccaaggaggagag
ggtaaaaaatag

DBGET integrated database retrieval system