KEGG   Homo sapiens (human): 487Help
Entry
487               CDS       T01001                                 

Gene name
ATP2A1, ATP2A, SERCA1
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04919  Thyroid hormone signaling pathway
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H01129  Brody myopathy
Drug target
Mipsagargin: D10715
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    487 (ATP2A1)
   04024 cAMP signaling pathway
    487 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    487 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    487 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    487 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    487 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    487 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    487 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    487 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    487 (ATP2A1)
   05414 Dilated cardiomyopathy (DCM)
    487 (ATP2A1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     487 (ATP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 487
NCBI-ProteinID: NP_775293
OMIM: 108730
HGNC: 811
Ensembl: ENSG00000196296
Vega: OTTHUMG00000131760
Pharos: O14983(Tchem)
UniProt: O14983 Q7Z675
LinkDB All DBs
Position
16p11.2
AA seq 1001 aa AA seqDB search
MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGML
DPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDD
LPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLR
ALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgctcatgctaaaaccacggaggaatgtttggcctattttggggtgagtgag
accacgggcctcaccccggaccaagttaagcggaatctggagaaatacggcctcaatgag
ctccctgctgaggaagggaagaccctgtgggagctggtgatagagcagtttgaagacctc
ctggtgcggattctcctcctggccgcatgcatttccttcgtgctggcctggtttgaggaa
ggtgaagagaccatcactgcctttgttgaaccctttgtcatcctcttgatcctcattgcc
aatgccatcgtgggggtttggcaggagcggaacgcagagaacgccatcgaggccctgaag
gagtatgagccagagatggggaaggtctaccgggctgaccgcaagtcagtgcaaaggatc
aaggctcgggacatcgtccctggggacatcgtggaggtggctgtgggggacaaagtccct
gcagacatccgaatcctcgccatcaaatccaccacgctgcgggttgaccagtccatcctg
acaggcgagtctgtatctgtcatcaaacacacggagcccgttcctgacccccgagctgtc
aaccaggacaagaagaacatgcttttctcgggcaccaacattgcagccggcaaggccttg
ggcatcgtggccaccactggtgtgggcaccgagattgggaagatccgagaccaaatggct
gccacagaacaggacaagacccccttgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctccctcatctgtgtggctgtctggcttatcaacattggccacttcaac
gaccccgtccatgggggctcctggttccgcggggccatctactactttaagattgccgtg
gccttggctgtggctgccatccccgaaggtcttcctgcagtcatcaccacctgcctggcc
ctgggtacccgtcggatggcaaagaagaatgccattgtaagaagcttgccctccgtagag
accctgggctgcacctctgtcatctgttccgacaagacaggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttatcattgacaaggtggatggggacatctgcctcctgaat
gagttctccatcaccggctccacttacgctccagagggagaggtcttgaagaatgataag
ccagtccggccagggcagtatgacgggctggtggagctggccaccatctgtgccctctgc
aatgactcctccttggacttcaacgaggccaaaggtgtctatgagaaggtcggcgaggcc
accgagacagcactcaccaccctggtggagaagatgaatgtgttcaacacggatgtgaga
agcctctcgaaggtggagagagccaacgcctgcaactcggtgatccgccagctaatgaag
aaggaattcaccctggagttctcccgagacagaaagtccatgtctgtctattgctcccca
gccaaatcttcccgggctgctgtgggcaacaagatgtttgtcaagggtgcccctgagggc
gtcatcgaccgctgtaactatgtgcgagttggcaccacccgggtgccactgacggggccg
gtgaaggaaaagatcatggcggtgatcaaggagtggggcactggccgggacaccctgcgc
tgcttggccctggccacccgggacacccccccgaagcgagaggaaatggtcctggatgac
tctgccaggttcctggagtatgagacggacctgacattcgtgggtgtagtgggcatgctg
gaccctccgcgcaaggaggtcacgggctccatccagctgtgccgtgacgccgggatccgg
gtgatcatgatcactggggacaacaagggcacagccattgccatctgccggcgaattggc
atctttggggagaacgaggaggtggccgatcgcgcctacacgggccgagagttcgacgac
ctgcccctggctgaacagcgggaagcctgccgacgtgcctgctgcttcgcccgtgtggag
ccctcgcacaagtccaagattgtggagtacctgcagtcctacgatgagatcacagccatg
acaggtgatggcgtcaatgacgcccctgccctgaagaaggctgagattggcattgccatg
ggatctggcactgccgtggccaagactgcctctgagatggtgctggctgacgacaacttc
tccaccatcgtagctgctgtggaggagggccgcgccatctacaacaacatgaagcagttc
atccgctacctcatttcctccaacgtgggcgaggtggtctgtatcttcctgaccgctgcc
ctggggctgcctgaggccctgatcccggtgcagctgctatgggtgaacttggtgaccgac
gggctcccagccacagccctgggcttcaacccaccagacctggacatcatggaccgcccc
ccccggagccccaaggagcccctcatcagtggctggctcttcttccgctacatggcaatc
gggggctatgtgggtgcagccaccgtgggagcagctgcctggtggttcctgtacgctgag
gatgggcctcatgtcaactacagccagctgactcacttcatgcagtgcaccgaggacaac
acccactttgagggcatagactgtgaggtcttcgaggcccccgagcccatgaccatggcc
ctgtccgtgctggtgaccatcgagatgtgcaatgcactgaacagcctgtccgagaaccag
tccctgctgcggatgccaccctgggtgaacatctggctgctgggctccatctgcctctcc
atgtccctgcacttcctcatcctctatgttgaccccctgccgatgatcttcaagctccgg
gccctggacctcacccagtggctcatggtcctcaagatctcactgccagtcattgggctc
gacgaaatcctcaagttcgttgctcggaactacctagaggatccagaagatgaaagaagg
aagtga

KEGG   Homo sapiens (human): 488Help
Entry
488               CDS       T01001                                 

Gene name
ATP2A2, ATP2B, DAR, DD, SERCA2
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04919  Thyroid hormone signaling pathway
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06322  TRH-TSH-TH signaling
  Element
N00798  Thyroid hormone signaling pathway
N00800  Mutation-inactivated THRB to thyroid hormone signaling pathway
Disease
H00715  Darier disease
H00755  Acrokeratosis verruciformis
Drug target
Mipsagargin: D10715
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    488 (ATP2A2)
   04024 cAMP signaling pathway
    488 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    488 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    488 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    488 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    488 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    488 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    488 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    488 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    488 (ATP2A2)
   05414 Dilated cardiomyopathy (DCM)
    488 (ATP2A2)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     488 (ATP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Motif
Other DBs
NCBI-GeneID: 488
NCBI-ProteinID: NP_733765
OMIM: 108740
HGNC: 812
Ensembl: ENSG00000174437
Vega: OTTHUMG00000169327
Pharos: P16615(Tbio)
UniProt: P16615 A0A0S2Z3L2
LinkDB All DBs
Structure
PDB: 

Position
12q24.11
AA seq 1042 aa AA seqDB search
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVL
LIMPLVIWVYSTDTNFSDMFWS
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcgcacaccaagacggtggaggaggtgctgggccacttcggcgtcaacgag
agtacggggctgagcctggaacaggtcaagaagcttaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagacttg
ctagttaggattttattactggcagcatgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccttttgtaattttactcatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgccatcgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtgcagcggatt
aaagctaaagacatagttcctggtgatattgtagaaattgctgttggtgacaaagttcct
gctgatataaggttaacttccatcaaatctaccacactaagagttgaccagtcaattctc
acaggtgaatctgtctctgtcatcaagcacactgatcccgtccctgacccacgagctgtc
aaccaagataaaaagaacatgctgttttctggtacaaacattgctgctgggaaagctatg
ggagtggtggtagcaactggagttaacaccgaaattggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacaccccttcagcaaaaactagatgaatttggggaacagctt
tccaaagtcatctcccttatttgcattgcagtctggatcataaatattgggcacttcaat
gacccggttcatggagggtcctggatcagaggtgctatttactactttaaaattgcagtg
gccctggctgtagcagccattcctgaaggtctgcctgcagtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgccattgttcgaagcctcccgtctgtggaa
acccttggttgtacttctgttatctgctcagacaagactggtacacttacaacaaaccag
atgtcagtctgcaggatgttcattctggacagagtggaaggtgatacttgttcccttaat
gagtttaccataactggatcaacttatgcacctattggagaagtgcataaagatgataaa
ccagtgaattgtcaccagtatgatggtctggtagaattagcaacaatttgtgctctttgt
aatgactctgctttggattacaatgaggcaaagggtgtgtatgaaaaagttggagaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaacgtgcaaatgcctgcaactcagtcattaaacagctgatgaaa
aaggaattcactctagagttttcacgtgacagaaagtcaatgtcggtttactgtacacca
aataaaccaagcaggacatcaatgagcaagatgtttgtgaagggtgctcctgaaggtgtc
attgacaggtgcacccacattcgagttggaagtactaaggttcctatgacctctggagtc
aaacagaagatcatgtctgtcattcgagagtggggtagtggcagcgacacactgcgatgc
ctggccctggccactcatgacaacccactgagaagagaagaaatgcaccttgaggactct
gccaactttattaaatatgagaccaatctgaccttcgttggctgcgtgggcatgctggat
cctccgagaatcgaggtggcctcctccgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcactggggacaacaagggcactgctgtggccatctgtcgccgcatcggcatc
ttcgggcaggatgaggacgtgacgtcaaaagctttcacaggccgggagtttgatgaactc
aacccctccgcccagcgagacgcctgcctgaacgcccgctgttttgctcgagttgaaccc
tcccacaagtctaaaatcgtagaatttcttcagtcttttgatgagattacagctatgact
ggcgatggcgtgaacgatgctcctgctctgaagaaagccgagattggcattgctatgggc
tctggcactgcggtggctaaaaccgcctctgagatggtcctggcggatgacaacttctcc
accattgtggctgccgttgaggaggggcgggcaatctacaacaacatgaaacagttcatc
cgctacctcatctcgtccaacgtcggggaagttgtctgtattttcctgacagcagccctt
ggatttcccgaggctttgattcctgttcagctgctctgggtcaatctggtgacagatggc
ctgcctgccactgcactggggttcaaccctcctgatctggacatcatgaataaacctccc
cggaacccaaaggaaccattgatcagcgggtggctctttttccgttacttggctattggc
tgttacgtcggcgctgctaccgtgggtgctgctgcatggtggttcattgctgctgacggt
ggtccaagagtgtccttctaccagctgagtcatttcctacagtgtaaagaggacaacccg
gactttgaaggcgtggattgtgcaatctttgaatccccatacccgatgacaatggcgctc
tctgttctagtaactatagaaatgtgtaacgccctcaacagcttgtccgaaaaccagtcc
ttgctgaggatgcccccctgggagaacatctggctcgtgggctccatctgcctgtccatg
tcactccacttcctgatcctctatgtcgaacccttgccactcatcttccagatcacaccg
ctgaacgtgacccagtggctgatggtgctgaaaatctccttgcccgtgattctcatggat
gagacgctcaagtttgtggcccgcaactacctggaacctggtaaagagtgtgtgcagcct
gccaccaaatcctgctcgttctcggcatgcaccgatgggatttcctggccgtttgtgctg
ctcataatgcccctggtgatctgggtctatagcacagacactaactttagcgatatgttc
tggtcttga

KEGG   Homo sapiens (human): 489Help
Entry
489               CDS       T01001                                 

Gene name
ATP2A3, SERCA3
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04919  Thyroid hormone signaling pathway
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Mipsagargin: D10715
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    489 (ATP2A3)
   04024 cAMP signaling pathway
    489 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    489 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    489 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    489 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    489 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    489 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    489 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    489 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    489 (ATP2A3)
   05414 Dilated cardiomyopathy (DCM)
    489 (ATP2A3)
Enzymes [BR:hsa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     489 (ATP2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Motif
Other DBs
NCBI-GeneID: 489
NCBI-ProteinID: NP_777615
OMIM: 601929
HGNC: 813
Ensembl: ENSG00000074370
Vega: OTTHUMG00000177674
Pharos: Q93084(Tbio)
UniProt: Q93084 A8K9K1
LinkDB All DBs
Position
17p13.2
AA seq 1043 aa AA seqDB search
MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT
SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML
DPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDD
LSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAI
GVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRNHMHACLYPGLLRTVSQAWSRQPLTTSWTPD
HTGRNEPEVSAGNRVESPVCTSD
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgcatctgctcccggccgccgacgtgctgcgccacttctcggtgacagcc
gagggcggcctgagcccggcgcaggtgaccggcgcgcgggagcgctacggccccaacgag
ctcccgagtgaggaagggaagtccctgtgggagctggtgctggaacagtttgaggacctc
ctggtgcgcatcctgctgctggctgcccttgtctcctttgtcctggcctggttcgaggag
ggcgaggagaccacgaccgccttcgtggagcccctggtcatcatgctgatcctcgtggcc
aacgccattgtgggcgtgtggcaggaacgcaacgccgagagtgccatcgaggccctgaag
gagtatgagcctgagatgggcaaggtgatccgctcggaccgcaagggcgtgcagaggatc
cgtgcccgggacatcgtcccaggggacattgtagaagtggcagtgggggacaaagtgcct
gctgacctccgcctcatcgagatcaagtccaccacgctgcgagtggaccagtccatcctg
acgggtgaatctgtgtccgtgaccaagcacacagaggccatcccagaccccagagctgtg
aaccaggacaagaagaacatgctgttttctggcaccaatatcacatcgggcaaagcggtg
ggtgtggccgtggccaccggcctgcacacggagctgggcaagatccggagccagatggcg
gcagtcgagcccgagcggacgccgctgcagcgcaagctggacgagtttggacggcagctg
tcccacgccatctctgtgatctgcgtggccgtgtgggtcatcaacatcggccacttcgcc
gacccggcccacggtggctcctggctgcgtggcgctgtctactacttcaagatcgccgtg
gccctggcggtggcggccatccccgagggcctcccggctgtcatcactacatgcctggca
ctgggcacgcggcgcatggcacgcaagaacgccatcgtgcgaagcctgccgtccgtggag
accctgggctgcacctcagtcatctgctccgacaagacgggcacgctcaccaccaatcag
atgtctgtctgccggatgttcgtggtagccgaggccgatgcgggctcctgccttttgcac
gagttcaccatctcgggtaccacgtatacccccgagggcgaagtgcggcagggggatcag
cctgtgcgctgcggccagttcgacgggctggtggagctggcgaccatctgcgccctgtgc
aacgactcggctctggactacaacgaggccaagggtgtgtatgagaaggtgggagaggcc
acggagacagctctgacttgcctggtggagaagatgaacgtgttcgacaccgacctgcag
gctctgtcccgggtggagcgagctggcgcctgtaacacggtcatcaagcagctgatgcgg
aaggagttcaccctggagttctcccgagaccggaaatccatgtccgtgtactgcacgccc
acccgccctcaccctactggccagggcagcaagatgtttgtgaagggggctcctgagagt
gtgatcgagcgctgtagctcagtccgcgtggggagccgcacagcacccctgacccccacc
tccagggagcagatcctggcaaagatccgggattggggctcaggctcagacacgctgcgc
tgcctggcactggccacccgggacgcgcccccaaggaaggaggacatggagctggacgac
tgcagcaagtttgtgcagtacgagacggacctgaccttcgtgggctgcgtaggcatgctg
gacccgccgcgacctgaggtggctgcctgcatcacacgctgctaccaggcgggcatccgc
gtggtcatgatcacgggggataacaaaggcactgccgtggccatctgccgcaggcttggc
atctttggggacacggaagacgtggcgggcaaggcctacacgggccgcgagtttgatgac
ctcagccccgagcagcagcgccaggcctgccgcaccgcccgctgcttcgcccgcgtggag
cccgcacacaagtcccgcatcgtggagaacctgcagtcctttaacgagatcactgctatg
actggcgatggagtgaacgacgcaccagccctgaagaaagcagagatcggcatcgccatg
ggctcaggcacggccgtggccaagtcggcggcagagatggtgctgtcagatgacaacttt
gcctccatcgtggctgcggtggaggagggccgggccatctacagcaacatgaagcaattc
atccgctacctcatctcctccaatgttggcgaggtcgtctgcatcttcctcacggcaatt
ctgggcctgcccgaagccctgatccctgtgcagctgctctgggtgaacctggtgacagac
ggcctacctgccacggctctgggcttcaacccgccagacctggacatcatggagaagctg
ccccggagcccccgagaagccctcatcagtggctggctcttcttccgatacctggctatc
ggagtgtacgtaggcctggccacagtggctgccgccacctggtggtttgtgtatgacgcc
gagggacctcacatcaacttctaccagctgaggaacttcctgaagtgctccgaagacaac
ccgctctttgccggcatcgactgtgaggtgttcgagtcacgcttccccaccaccatggcc
ttgtccgtgctcgtgaccattgaaatgtgcaatgccctcaacagcgtctcggagaaccag
tcgctgctgcggatgccgccctggatgaacccctggctgctggtggctgtggccatgtcc
atggccctgcacttcctcatcctgctcgtgccgcccctgcctctcattttccaggtgacc
ccactgagcgggcgccagtgggtggtggtgctccagatatctctgcctgtcatcctgctg
gatgaggccctcaagtacctgtcccggaaccacatgcacgcctgtctttatccaggcctt
ctcaggacagtctcgcaggcctggagtaggcagccgctgaccacctcttggaccccagac
cacaccggaagaaatgagccagaagtgagcgctgggaacagagtggagtctccggtgtgt
acctcagactga

DBGET integrated database retrieval system