KEGG   Homo sapiens (human): 4899
Entry
4899              CDS       T01001                                 

Gene name
NRF1, ALPHA-PAL
Definition
(RefSeq) nuclear respiratory factor 1
  KO
K11831  nuclear respiratory factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4899 (NRF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    4899 (NRF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4899 (NRF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    4899 (NRF1)
SSDB
Motif
Pfam: Nrf1_DNA-bind Nrf1_activ_bdg DUF3459 Peptidase_M23
Other DBs
NCBI-GeneID: 4899
NCBI-ProteinID: NP_001035199
OMIM: 600879
HGNC: 7996
Ensembl: ENSG00000106459
Vega: OTTHUMG00000143736
Pharos: Q16656(Tbio)
UniProt: Q16656 A0A024R770
LinkDB
Position
7q32.2
AA seq 503 aa
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggaacacggagtgacccaaaccgaacatatggctaccatagaagcacatgcagtg
gcccagcaagtgcagcaggtccatgtggctacttacaccgagcatagtatgctgagtgct
gatgaagactcgccttcttctcccgaggacacctcttacgatgactcagatatactcaac
tccacagcagctgatgaggtgacagctcatctggcagctgcaggtcctgtgggaatggcc
gctgctgctgctgtggcaacaggaaagaaacggaaacggcctcatgtatttgagtctaat
ccatctatccggaagaggcaacaaacacgtttgcttcggaaacttcgagccacgttagat
gaatatactactcgtgtgggacagcaagctattgtcctctgtatctcaccctccaaacct
aaccctgtctttaaagtgtttggtgcagcacctttggagaatgtggtgcgtaagtacaag
agcatgatcctggaagacctggagtctgctctggcagaacacgcccctgcgccacaggag
gttaactcagaactgccgcctctcaccatcgacggaattccagtctctgtggacaaaatg
acccaggcccagcttcgggcatttatcccagagatgctcaagtactctacaggtcgggga
aaaccaggctgggggaaagaaagctgcaagcccatctggtggcctgaagatatcccctgg
gcaaatgtccggagtgatgtccgcacagaagagcaaaagcagagggtttcatggacccag
gcactacggaccatagttaaaaactgttataaacagcatgggcgggaagaccttttgtat
gcctttgaagatcagcaaacgcaaacacaggccacagccacacatagtatagctcatctt
gtaccatcacagactgtagtccagacttttagtaaccctgatggcactgtctcacttatc
caggttggtacgggggcaacagtagccacattggctgatgcttcagaattgccaaccacg
gtcaccgttgcccaagtgaattattctgccgtggctgatggagaggtggaacaaaattgg
gccacgttacagggaggtgagatgaccatccagacgacgcaagcatcagaggccacccag
gcggtggcatcgttggcagaggccgcagtggcagcttctcaggagatgcagcagggagct
acagtcactatggcgcttaacagcgaagctgccgcccatgctgtcgccaccctggctgag
gccaccttacaaggtgggggacagatcgtcttgtctggggaaaccgcagcagccgtcgga
gcacttactggagtccaagatgctaatggcctggtccagatccctgtgagcatgtaccag
actgtggtgaccagcctcgcccagggcaacggaccagtgcaggtggccatggcccctgtg
accaccaggatatcagacagcgcagtcaccatggacggccaagctgtggaggtggtgaca
ttggaacagtga

DBGET integrated database retrieval system