KEGG   Homo sapiens (human): 4914Help
Entry
4914              CDS       T01001                                 

Gene name
NTRK1, MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05216  Thyroid cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06210  ERK signaling
nt06240  Transcription
nt06274  Thyroid cancer
  Element
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00132  Amplified MYCN to transcriptional repression
Disease
H00032  Thyroid cancer
H00043  Neuroblastoma
H00265  Hereditary sensory and autonomic neuropathy
H01836  Congenital pain insensitivity with anhidrosis
Drug target
Entrectinib: D10926
Larotrectinib (DG02923): D11137 D11138
Pegcantratinib: D11484
Repotrectinib: D11454
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4914 (NTRK1)
   04010 MAPK signaling pathway
    4914 (NTRK1)
   04151 PI3K-Akt signaling pathway
    4914 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4914 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4914 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    4914 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4914 (NTRK1)
   05202 Transcriptional misregulation in cancer
    4914 (NTRK1)
   05230 Central carbon metabolism in cancer
    4914 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    4914 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4914 (NTRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     4914 (NTRK1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   4914 (NTRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 I-set LRR_8 TrkA_TMD Ig_3 Ig_2 LRR_4
Motif
Other DBs
NCBI-GeneID: 4914
NCBI-ProteinID: NP_002520
OMIM: 191315
HGNC: 8031
Ensembl: ENSG00000198400
Vega: OTTHUMG00000041304
Pharos: P04629(Tchem)
UniProt: P04629
LinkDB All DBs
Structure
PDB: 

Position
1q23.1
AA seq 796 aa AA seqDB search
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggcggacggcgcgggcagcttggctggcacagctgggctgcggggccgggc
agcctgctggcttggctgatactggcatctgcgggcgccgcaccctgccccgatgcctgc
tgcccccacggctcctcgggactgcgatgcacccgggatggggccctggatagcctccac
cacctgcccggcgcagagaacctgactgagctctacatcgagaaccagcagcatctgcag
catctggagctccgtgatctgaggggcctgggggagctgagaaacctcaccatcgtgaag
agtggtctccgtttcgtggcgccagatgccttccatttcactcctcggctcagtcgcctg
aatctctccttcaacgctctggagtctctctcctggaaaactgtgcagggcctctcctta
caggaactggtcctgtcggggaaccctctgcactgttcttgtgccctgcgctggctacag
cgctgggaggaggagggactgggcggagtgcctgaacagaagctgcagtgtcatgggcaa
gggcccctggcccacatgcccaatgccagctgtggtgtgcccacgctgaaggtccaggtg
cccaatgcctcggtggatgtgggggacgacgtgctgctgcggtgccaggtggaggggcgg
ggcctggagcaggccggctggatcctcacagagctggagcagtcagccacggtgatgaaa
tctgggggtctgccatccctggggctgaccctggccaatgtcaccagtgacctcaacagg
aagaacgtgacgtgctgggcagagaacgatgtgggccgggcagaggtctctgttcaggtc
aacgtctccttcccggccagtgtgcagctgcacacggcggtggagatgcaccactggtgc
atccccttctctgtggatgggcagccggcaccgtctctgcgctggctcttcaatggctcc
gtgctcaatgagaccagcttcatcttcactgagttcctggagccggcagccaatgagacc
gtgcggcacgggtgtctgcgcctcaaccagcccacccacgtcaacaacggcaactacacg
ctgctggctgccaaccccttcggccaggcctccgcctccatcatggctgccttcatggac
aaccctttcgagttcaaccccgaggaccccatccctgtctccttctcgccggtggacact
aacagcacatctggagacccggtggagaagaaggacgaaacaccttttggggtctcggtg
gctgtgggcctggccgtctttgcctgcctcttcctttctacgctgctccttgtgctcaac
aaatgtggacggagaaacaagtttgggatcaaccgcccggctgtgctggctccagaggat
gggctggccatgtccctgcatttcatgacattgggtggcagctccctgtcccccaccgag
ggcaaaggctctgggctccaaggccacatcatcgagaacccacaatacttcagtgatgcc
tgtgttcaccacatcaagcgccgggacatcgtgctcaagtgggagctgggggagggcgcc
tttgggaaggtcttccttgctgagtgccacaacctcctgcctgagcaggacaagatgctg
gtggctgtcaaggcactgaaggaggcgtccgagagtgctcggcaggacttccagcgtgag
gctgagctgctcaccatgctgcagcaccagcacatcgtgcgcttcttcggcgtctgcacc
gagggccgccccctgctcatggtctttgagtatatgcggcacggggacctcaaccgcttc
ctccgatcccatggacctgatgccaagctgctggctggtggggaggatgtggctccaggc
cccctgggtctggggcagctgctggccgtggctagccaggtcgctgcggggatggtgtac
ctggcgggtctgcattttgtgcaccgggacctggccacacgcaactgtctagtgggccag
ggactggtggtcaagattggtgattttggcatgagcagggatatctacagcaccgactat
taccgtgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctg
taccgtaagttcaccaccgagagcgacgtgtggagcttcggcgtggtgctctgggagatc
ttcacctacggcaagcagccctggtaccagctctccaacacggaggcaatcgactgcatc
acgcagggacgtgagttggagcggccacgtgcctgcccaccagaggtctacgccatcatg
cggggctgctggcagcgggagccccagcaacgccacagcatcaaggatgtgcacgcccgg
ctgcaagccctggcccaggcacctcctgtctacctggatgtcctgggctag

KEGG   Homo sapiens (human): 4804Help
Entry
4804              CDS       T01001                                 

Gene name
NGFR, CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Definition
(RefSeq) nerve growth factor receptor
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04215  Apoptosis - multiple species
hsa04722  Neurotrophin signaling pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00132  Amplified MYCN to transcriptional repression
Drug target
Cenegermin: D11028
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4804 (NGFR)
   04015 Rap1 signaling pathway
    4804 (NGFR)
   04010 MAPK signaling pathway
    4804 (NGFR)
   04151 PI3K-Akt signaling pathway
    4804 (NGFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4804 (NGFR)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    4804 (NGFR)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4804 (NGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4804 (NGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4804 (NGFR)
   04090 CD molecules [BR:hsa04090]
    4804 (NGFR)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   4804 (NGFR)
CD molecules [BR:hsa04090]
 Proteins
  4804 (NGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Motif
Other DBs
NCBI-GeneID: 4804
NCBI-ProteinID: NP_002498
OMIM: 162010
HGNC: 7809
Ensembl: ENSG00000064300
Vega: OTTHUMG00000161495
Pharos: P08138(Tchem)
UniProt: P08138
LinkDB All DBs
Structure
PDB: 

Position
17q21.33
AA seq 427 aa AA seqDB search
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt
ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacacagc
ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac
cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcgacc
gagccgtgcaagccgtgcaccgagtgcgtggggctccagagcatgtcggcgccgtgcgtg
gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg
cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcctgccaggac
aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac
gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc
acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca
cccccagagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa
caagacctcatagccagcacggtggcaggtgtggtgaccacagtgatgggcagctcccag
cccgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct
gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag
aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa
ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccac
acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc
ccagccaagcgggaggaggtggagaagcttctcaacggctctgcgggggacacctggcgg
cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccatgaggcc
tgccccgttcgcgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc
ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag
tccactgccacatccccggtgtga

DBGET integrated database retrieval system