KEGG   Homo sapiens (human): 4917Help
Entry
4917              CDS       T01001                                 

Gene name
NTN3, NTN2L
Definition
(RefSeq) netrin 3
  KO
K06844  netrin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    4917 (NTN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N NTR Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 4917
NCBI-ProteinID: NP_006172
OMIM: 602349
HGNC: 8030
Ensembl: ENSG00000162068
Vega: OTTHUMG00000128867
Pharos: O00634(Tdark)
UniProt: O00634
LinkDB All DBs
Position
16p13.3
AA seq 580 aa AA seqDB search
MPGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCG
RPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
SLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPA
PLAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTRPSTAGDPRDMEAVV
PYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRA
TARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRD
PGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAP
CVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAW
TRFPVAVLAVFRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAG
GRGPGLIAARGSLVLPWRDAWTRRLRRLQRRERRGRCSAA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctggccctgggggctgctgctgacggcaggcacgctcttcgccgccctgagt
cctgggccgccggcgcccgccgacccctgccacgatgaggggggtgcgccccgcggctgc
gtgccaggactggtgaacgccgccctgggccgcgaggtgctggcttccagcacgtgcggg
cggccggccactcgggcctgcgacgcctccgacccgcgacgggcacactcccccgccctc
cttacttccccagggggcacggccagccctctgtgctggcgctcggagtccctgcctcgg
gcgcccctcaacgtgactctcacggtgcccctgggcaaggcttttgagctggtcttcgtg
agcctgcgcttctgctcagctcccccagcctccgtggccctgctcaagtctcaggaccat
ggccgcagctgggccccgctgggcttcttctcctcccactgtgacctggactatggccgt
ctgcctgcccctgccaatggcccagctggcccagggcctgaggccctgtgcttccccgca
cccctggcccagcctgatggcagcggccttctggccttcagcatgcaggacagcagcccc
ccaggcctggacctggacagcagcccagtgctccaagactgggtgaccgccaccgacgtc
cgtgtagtgctcacaaggcctagcacggcaggtgaccccagggacatggaggccgtcgtc
ccttactcctacgcagccaccgacctccaggtgggcgggcgctgcaagtgcaatggacat
gcctcacggtgcctgctggacacacagggccacctgatctgcgactgtcggcatggcacc
gagggccctgactgcggccgctgcaagcccttctactgcgacaggccatggcagcgggcc
actgcccgggaatcccacgcctgcctcgcttgctcctgcaacggccatgcccgccgctgc
cgcttcaacatggagctgtaccgactgtccggccgccgcagcgggggtgtctgtctcaac
tgccggcacaacaccgccggccgccactgccactactgccgggagggcttctatcgagac
cctggccgtgccctgagtgaccgtcgggcttgcagggcctgcgactgtcacccggttggt
gctgctggcaagacctgcaaccagaccacaggccagtgtccctgcaaggatggcgtcact
ggcctcacctgcaaccgctgcgcgcctggcttccagcaaagccgctccccagtggcgccc
tgtgttaagacccctatccctggacccactgaggacagcagccctgtgcagccccaggac
tgtgactcgcactgcaaacctgcccgtggcagctaccgcatcagcctaaagaagttctgc
aagaaggactatgcggtgcaggtggcggtgggtgcgcgcggcgaggcgcgcggcgcgtgg
acacgcttcccggtggcggtgctcgccgtgttccggagcggagaggagcgcgcgcggcgc
gggagtagcgcgctgtgggtgcccgccggggatgcggcctgcggctgcccgcgcctgctc
cccggccgccgctacctcctgctggggggcgggcctggagccgcggctgggggcgcgggg
ggccgggggcccgggctcatcgccgcccgcggaagcctcgtgctaccctggagggacgcg
tggacgcggcgcctgcggaggctgcagcgacgcgaacggcgggggcgctgcagcgccgcc
tga

DBGET integrated database retrieval system