KEGG   Homo sapiens (human): 4938Help
Entry
4938              CDS       T01001                                 

Gene name
OAS1, E18/E16, IFI-4, OIAS, OIASI
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4938 (OAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4938 (OAS1)
   05164 Influenza A
    4938 (OAS1)
   05160 Hepatitis C
    4938 (OAS1)
   05168 Herpes simplex virus 1 infection
    4938 (OAS1)
   05169 Epstein-Barr virus infection
    4938 (OAS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4938 (OAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 4938
NCBI-ProteinID: NP_058132
OMIM: 164350
HGNC: 8086
Ensembl: ENSG00000089127
Vega: OTTHUMG00000169792
Pharos: P00973(Tbio)
UniProt: P00973
LinkDB All DBs
Structure
PDB: 

Position
12q24.13
AA seq 400 aa AA seqDB search
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctcagaaataccccagccaaatctctggacaagttcattgaagactatctc
ttgccagacacgtgtttccgcatgcaaatcaaccatgccattgacatcatctgtgggttc
ctgaaggaaaggtgcttccgaggtagctcctaccctgtgtgtgtgtccaaggtggtaaag
ggtggctcctcaggcaagggcaccaccctcagaggccgatctgacgctgacctggttgtc
ttcctcagtcctctcaccacttttcaggatcagttaaatcgccggggagagttcatccag
gaaattaggagacagctggaagcctgtcaaagagagagagcattttccgtgaagtttgag
gtccaggctccacgctggggcaacccccgtgcgctcagcttcgtactgagttcgctccag
ctcggggagggggtggagttcgatgtgctgcctgcctttgatgccctgggtcagttgact
ggcggctataaacctaacccccaaatctatgtcaagctcatcgaggagtgcaccgacctg
cagaaagagggcgagttctccacctgcttcacagaactacagagagacttcctgaagcag
cgccccaccaagctcaagagcctcatccgcctagtcaagcactggtaccaaaattgtaag
aagaagcttgggaagctgccacctcagtatgccctggagctcctgacggtctatgcttgg
gagcgagggagcatgaaaacacatttcaacacagcccagggatttcggacggtcttggaa
ttagtcataaactaccagcaactctgcatctactggacaaagtattatgactttaaaaac
cccattattgaaaagtacctgagaaggcagctcacgaaacccaggcctgtgatcctggac
ccggcggaccctacaggaaacttgggtggtggagacccaaagggttggaggcagctggca
caagaggctgaggcctggctgaattacccatgctttaagaattgggatgggtccccagtg
agctcctggattctgctggctgaaagcaacagtgcagacgatgagaccgacgatcccagg
aggtatcagaaatatggttacattggaacacatgagtaccctcatttctctcatagaccc
agcacactccaggcagcatccaccccacaggcagaagaggactggacctgcaccatcctc
tga

KEGG   Homo sapiens (human): 4939Help
Entry
4939              CDS       T01001                                 

Gene name
OAS2
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4939 (OAS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4939 (OAS2)
   05164 Influenza A
    4939 (OAS2)
   05160 Hepatitis C
    4939 (OAS2)
   05168 Herpes simplex virus 1 infection
    4939 (OAS2)
   05169 Epstein-Barr virus infection
    4939 (OAS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4939 (OAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Motif
Other DBs
NCBI-GeneID: 4939
NCBI-ProteinID: NP_058197
OMIM: 603350
HGNC: 8087
Ensembl: ENSG00000111335
Vega: OTTHUMG00000169802
Pharos: P29728(Tbio)
UniProt: P29728
LinkDB All DBs
Position
12q24.13
AA seq 719 aa AA seqDB search
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIG
GSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEI
QKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVC
FTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKD
NFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNN
VSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNK
CFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS
YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSF
DVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLK
DLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVT
QYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEA
KEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggggagtcccagctgtcctcggtgcctgctcagaagctgggttggtttatc
caggaatacctgaagccctacgaagaatgtcagacactgatcgacgagatggtgaacacc
atctgtgacgtcctgcaggaacccgaacagttccccctggtgcagggagtggccataggt
ggctcctatggacggaaaacagtcttaagaggcaactccgatggtacccttgtcctcttc
ttcagtgacttaaaacaattccaggatcagaagagaagccaacgtgacatcctcgataaa
actggggataagctgaagttctgtctgttcacgaagtggttgaaaaacaatttcgagatc
cagaagtcccttgatgggttcaccatccaggtgttcacaaaaaatcagagaatctctttc
gaggtgctggccgccttcaacgctctgagcttaaatgataatcccagcccctggatctat
cgagagctcaaaagatccttggataagacaaatgccagtcctggtgagtttgcagtctgc
ttcactgaactccagcagaagttttttgacaaccgtcctggaaaactaaaggatttgatc
ctcttgataaagcactggcatcaacagtgccagaaaaaaatcaaggatttaccctcgctg
tctccgtatgccctggagctgcttacggtgtatgcctgggaacaggggtgcagaaaagac
aactttgacattgctgaaggcgtcagaaccgtactggagctgatcaaatgccaggagaag
ctgtgtatctattggatggtcaactacaactttgaagatgagaccatcaggaacatcctg
ctgcaccagctccaatcagcgaggccagtaatcttggatccagttgacccaaccaataat
gtgagtggagataaaatatgctggcaatggctgaaaaaagaagctcaaacctggttgact
tctcccaacctggataatgagttacctgcaccatcttggaatgttctgcctgcaccactc
ttcacgaccccaggccaccttctggataagttcatcaaggagtttctccagcccaacaaa
tgcttcctagagcagattgacagtgctgttaacatcatccgtacattccttaaagaaaac
tgcttccgacaatcaacagccaagatccagattgtccggggaggatcaaccgccaaaggc
acagctctgaagactggctctgatgccgatctcgtcgtgttccataactcacttaaaagc
tacacctcccaaaaaaacgagcggcacaaaatcgtcaaggaaatccatgaacagctgaaa
gccttttggagggagaaggaggaggagcttgaagtcagctttgagcctcccaagtggaag
gctcccagggtgctgagcttctctctgaaatccaaagtcctcaacgaaagtgtcagcttt
gatgtgcttcctgcctttaatgcactgggtcagctgagttctggctccacacccagcccc
gaggtttatgcagggctcattgatctgtataaatcctcggacctcccgggaggagagttt
tctacctgtttcacagtcctgcagcgaaacttcattcgctcccggcccaccaaactaaag
gatttaattcgcctggtgaagcactggtacaaagagtgtgaaaggaaactgaagccaaag
gggtctttgcccccaaagtatgccttggagctgctcaccatctatgcctgggagcagggg
agtggagtgccggattttgacactgcagaaggtttccggacagtcctggagctggtcaca
caatatcagcagctctgcatcttctggaaggtcaattacaactttgaagatgagaccgtg
aggaagtttctactgagccagttgcagaaaaccaggcctgtgatcttggacccagccgaa
cccacaggtgacgtgggtggaggggaccgttggtgttggcatcttctggcaaaagaagca
aaggaatggttatcctctccctgcttcaaggatgggactggaaacccaataccaccttgg
aaagtgccgacaatgcagacaccaggaagttgtggagctaggatccatcctattgtcaat
gagatgttctcatccagaagccatagaatcctgaataataattctaaaagaaacttctag

KEGG   Homo sapiens (human): 4940Help
Entry
4940              CDS       T01001                                 

Gene name
OAS3, p100, p100OAS
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4940 (OAS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4940 (OAS3)
   05164 Influenza A
    4940 (OAS3)
   05160 Hepatitis C
    4940 (OAS3)
   05168 Herpes simplex virus 1 infection
    4940 (OAS3)
   05169 Epstein-Barr virus infection
    4940 (OAS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4940 (OAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Motif
Other DBs
NCBI-GeneID: 4940
NCBI-ProteinID: NP_006178
OMIM: 603351
HGNC: 8088
Ensembl: ENSG00000111331
Vega: OTTHUMG00000169795
Pharos: Q9Y6K5(Tbio)
UniProt: Q9Y6K5
LinkDB All DBs
Structure
PDB: 

Position
12q24.13
AA seq 1087 aa AA seqDB search
MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKG
GSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTF
PEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEH
AACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQG
CKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPAD
PTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLD
PNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFL
NCFTDYKDQGPRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSW
TDVSLLPAFDAVGQLSSGTKPNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKN
LILLVKHWYRQVAAQNKGKGPAPASLPPAYALELLTIFAWEQGCRQDCFNMAQGFRTVLG
LVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLDPADPTWNVGHGSWELLAQEA
AALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFLAQVNKAVDTI
CSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLV
SGSRPSSQVYVDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKIS
KGRGSLPPQHGLELLTVYAWEQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKD
KTVGDFLKQQLQKPRPIILDPADPTGNLGHNARWDLLAKEAAACTSALCCMGRNGIPIQP
WPVKAAV
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagcaccccggccgctgcgctggacaggttcgtggccagaaggctgcag
ccgcggaaggagttcgtagagaaggcgcggcgcgctctgggcgccctggccgctgccctg
agggagcgcgggggccgcctcggtgctgctgccccgcgggtgctgaaaactgtcaaggga
ggctcctcgggccggggcacagctctcaagggtggctgtgattctgaacttgtcatcttc
ctcgactgcttcaagagctatgtggaccagagggcccgccgtgcagagatcctcagtgag
atgcgggcatcgctggaatcctggtggcagaacccagtccctggtctgagactcacgttt
cctgagcagagcgtgcctggggccctgcagttccgcctgacatccgtagatcttgaggac
tggatggatgttagcctggtgcctgccttcaatgtcctgggtcaggccggctccggcgtc
aaacccaagccacaagtctactctaccctcctcaacagtggctgccaagggggcgagcat
gcggcctgcttcacagagctgcggaggaactttgtgaacattcgcccagccaagttgaag
aacctaatcttgctggtgaagcactggtaccaccaggtgtgcctacaggggttgtggaag
gagacgctgcccccggtctatgccctggaattgctgaccatcttcgcctgggagcagggc
tgtaagaaggatgctttcagcctagccgaaggcctccgaactgtcctgggcctgatccaa
cagcatcagcacctgtgtgttttctggactgtcaactatggcttcgaggaccctgcagtt
gggcagttcttgcagcggcagcttaagagacccaggcctgtgatcctggacccagctgac
cccacatgggacctggggaatggggcagcctggcactgggatttgctagcccaggaggca
gcatcctgctatgaccacccatgctttctgagggggatgggggacccagtgcagtcttgg
aaggggccgggccttccacgtgctggatgctcaggtttgggccaccccatccagctagac
cctaaccagaagacccctgaaaacagcaagagcctcaatgctgtgtacccaagagcaggg
agcaaacctccctcatgcccagctcctggccccactggggcagccagcatcgtcccctct
gtgccgggaatggccttggacctgtctcagatccccaccaaggagctggaccgcttcatc
caggaccacctgaagccgagcccccagttccaggagcaggtgaaaaaggccattgacatc
atcttgcgctgcctccatgagaactgtgttcacaaggcctcaagagtcagtaaagggggc
tcatttggccggggcacagacctaagggatggctgtgatgttgaactcatcatcttcctc
aactgcttcacggactacaaggaccaggggccccgccgcgcagagatccttgatgagatg
cgagcgcagctagaatcctggtggcaggaccaggtgcccagcctgagccttcagtttcct
gagcagaatgtgcctgaggctctgcagttccagctggtgtccacagccctgaagagctgg
acggatgttagcctgctgcctgccttcgatgctgtggggcagctcagttctggcaccaaa
ccaaatccccaggtctactcgaggctcctcaccagtggctgccaggagggcgagcataag
gcctgcttcgcagagctgcggaggaacttcatgaacattcgccctgtcaagctgaagaac
ctgattctgctggtgaagcactggtaccgccaggttgcggctcagaacaaaggaaaagga
ccagcccctgcctctctgcccccagcctatgccctggagctcctcaccatctttgcctgg
gagcagggctgcaggcaggattgtttcaacatggcccaaggcttccggacggtgctgggg
ctcgtgcaacagcatcagcagctctgtgtctactggacggtcaactatagcactgaggac
ccagccatgagaatgcaccttcttggccagcttcgaaaacccagacccctggtcctggac
cccgctgatcccacctggaacgtgggccacggtagctgggagctgttggcccaggaagca
gcagcgctggggatgcaggcctgctttctgagtagagacgggacatctgtgcagccctgg
gatgtgatgccagccctcctttaccaaaccccagctggggaccttgacaagttcatcagt
gaatttctccagcccaaccgccagttcctggcccaggtgaacaaggccgttgataccatc
tgttcatttttgaaggaaaactgcttccggaattctcccatcaaagtgatcaaggtggtc
aagggtggctcttcagccaaaggcacagctctgcgaggccgctcagatgccgacctcgtg
gtgttcctcagctgcttcagccagttcactgagcagggcaacaagcgggccgagatcatc
tccgagatccgagcccagctggaggcatgtcaacaggagcggcagttcgaggtcaagttt
gaagtctccaaatgggagaatccccgcgtgctgagcttctcactgacatcccagacgatg
ctggaccagagtgtggactttgatgtgctgccagcctttgacgccctaggccagctggtc
tctggctccaggcccagctctcaagtctacgtcgacctcatccacagctacagcaatgcg
ggcgagtactccacctgcttcacagagctacaacgggacttcatcatctctcgccctacc
aagctgaagagcctgatccggctggtgaagcactggtaccagcagtgtaccaagatctcc
aaggggagaggctccctacccccacagcacgggctggaactcctgactgtgtatgcctgg
gagcagggcgggaaggactcccagttcaacatggctgagggcttccgcacggtcctggag
ctggtcacccagtaccgccagctctgtatctactggaccatcaactacaacgccaaggac
aagactgttggagacttcctgaaacagcagcttcagaagcccaggcctatcatcctggat
ccggctgacccgacaggcaacctgggccacaatgcccgctgggacctgctggccaaggaa
gctgcagcctgcacatctgccctgtgctgcatgggacggaatggcatccccatccagcca
tggccagtgaaggctgctgtgtga

KEGG   Homo sapiens (human): 27102Help
Entry
27102             CDS       T01001                                 

Gene name
EIF2AK1, HCR, HRI
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27102 (EIF2AK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    27102 (EIF2AK1)
   05160 Hepatitis C
    27102 (EIF2AK1)
   05168 Herpes simplex virus 1 infection
    27102 (EIF2AK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    27102 (EIF2AK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27102 (EIF2AK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   27102 (EIF2AK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH SlyX PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 27102
NCBI-ProteinID: NP_055228
OMIM: 613635
HGNC: 24921
Ensembl: ENSG00000086232
Vega: OTTHUMG00000090689
Pharos: Q9BQI3(Tchem)
UniProt: Q9BQI3 A0A024QZU1
LinkDB All DBs
Position
7p22.1
AA seq 630 aa AA seqDB search
MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFP
FAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVI
QPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQ
NNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSHLEESFTSTEE
SSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRN
GKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGL
RTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQ
EKEIAELKKQLNLLSQDKGVRDDGKDGGVG
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggggcaactccggggtccgcaagcgcgaagaggagggcgacggggctggggct
gtggctgcgccgccggccatcgactttcccgccgagggcccggaccccgaatatgacgaa
tctgatgttccagcagaaatccaggtgttaaaagaacccctacaacagccaaccttccct
tttgcagttgcaaaccaactcttgctggtttctttgctggagcacttgagccacgtgcat
gaaccaaacccacttcgttcaagacaggtgtttaagctactttgccagacgtttatcaaa
atggggctgctgtcttctttcacttgtagtgacgagtttagctcattgagactacatcac
aacagagctattactcacttaatgaggtctgctaaagagagagttcgtcaggatccttgt
gaggatatttctcgtatccagaaaatcagatcaagggaagtagccttggaagcacaaact
tcacgttacttaaatgaatttgaagaacttgccatcttaggaaaaggtggatacggaaga
gtatacaaggtcaggaataaattagatggtcagtattatgcaataaaaaaaatcctgatt
aagggtgcaactaaaacagtttgcatgaaggtcctacgggaagtgaaggtgctggcaggt
cttcagcaccccaatattgttggctatcacaccgcgtggatagaacatgttcatgtgatt
cagccacgagcagacagagctgccattgagttgccatctctggaagtgctctccgaccag
gaagaggacagagagcaatgtggtgttaaaaatgatgaaagtagcagctcatccattatc
tttgctgagcccaccccagaaaaagaaaaacgctttggagaatctgacactgaaaatcag
aataacaagtcggtgaagtacaccaccaatttagtcataagagaatctggtgaacttgag
tcgaccctggagctccaggaaaatggcttggctggtttgtctgccagttcaattgtggaa
cagcagctgccactcaggcgtaattcccacctagaggagagtttcacatccaccgaagaa
tcttccgaagaaaatgtcaactttttgggtcagacagaggcacagtaccacctgatgctg
cacatccagatgcagctgtgtgagctctcgctgtgggattggatagtcgagagaaacaag
cggggccgggagtatgtggacgagtctgcctgtccttatgttatggccaatgttgcaaca
aaaatttttcaagaattggtagaaggtgtgttttacatacataacatgggaattgtgcac
cgagatctgaagccaagaaatatttttcttcatggccctgatcagcaagtaaaaatagga
gactttggtctggcctgcacagacatcctacagaagaacacagactggaccaacagaaac
gggaagagaacaccaacacatacgtccagagtgggtacttgtctgtacgcttcacccgaa
cagttggaaggatctgagtatgatgccaagtcagatatgtacagcttgggtgtggtcctg
ctagagctctttcagccgtttggaacagaaatggagcgagcagaagttctaacaggttta
agaactggtcagttgccggaatccctccgtaaaaggtgtccagtgcaagccaagtatatc
cagcacttaacgagaaggaactcatcgcagagaccatctgccattcagctgctgcagagt
gaacttttccaaaattctggaaatgttaacctcaccctacagatgaagataatagagcaa
gaaaaagaaattgcagaactaaagaagcagctaaacctcctttctcaagacaaaggggtg
agggatgacggaaaggatgggggcgtgggatga

KEGG   Homo sapiens (human): 5610Help
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04217  Necroptosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06122  IFN signaling (viruses)
nt06138  PKR-eIF2alpha signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00571  PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00696  MV C to PKR-eIF2alpha signaling pathway
N00725  IAV NS1 to PKR-eIF2alpha signaling pathway
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5610 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05160 Hepatitis C
    5610 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    5610 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
   05165 Human papillomavirus infection
    5610 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5610 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5610 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dsrm Kinase-like Kdo DND1_DSRM Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 5610
NCBI-ProteinID: NP_001129123
OMIM: 176871
HGNC: 9437
Ensembl: ENSG00000055332
Vega: OTTHUMG00000100962
Pharos: P19525(Tbio)
UniProt: P19525 Q8IW76
LinkDB All DBs
Structure
PDB: 

Position
2p22.2
AA seq 551 aa AA seqDB search
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

KEGG   Homo sapiens (human): 9451Help
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Disease
H00512  Permanent neonatal diabetes mellitus
H00766  Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9451 (EIF2AK3)
   04137 Mitophagy - animal
    9451 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9451 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9451 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    9451 (EIF2AK3)
   05160 Hepatitis C
    9451 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    9451 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   9451 (EIF2AK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PQQ_2 Kdo APH OATP
Motif
Other DBs
NCBI-GeneID: 9451
NCBI-ProteinID: NP_004827
OMIM: 604032
HGNC: 3255
Ensembl: ENSG00000172071
Vega: OTTHUMG00000155046
Pharos: Q9NZJ5(Tchem)
UniProt: Q9NZJ5 B3KY45
LinkDB All DBs
Structure
PDB: 

Position
2p11.2
AA seq 1116 aa AA seqDB search
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

KEGG   Homo sapiens (human): 440275Help
Entry
440275            CDS       T01001                                 

Gene name
EIF2AK4, GCN2, PVOD2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 4
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Disease
H01621  Pulmonary arterial hypertension
H01866  Pulmonary veno-occlusive disease and pulmonary capillary hemangiomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    440275 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    440275 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    440275 (EIF2AK4)
   05160 Hepatitis C
    440275 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    440275 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    440275 (EIF2AK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     440275 (EIF2AK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   440275 (EIF2AK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 440275
NCBI-ProteinID: NP_001013725
OMIM: 609280
HGNC: 19687
Ensembl: ENSG00000128829
Vega: OTTHUMG00000172403
Pharos: Q9P2K8(Tchem)
UniProt: Q9P2K8
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 1649 aa AA seqDB search
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEK
NGCHESEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIH
EKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLT
NVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
REASDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVLAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4950 nt NT seq  +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagcctccggagagctacccg
caacgacaggaccacgagctacaggccctggaggccatttacggcgcggacttccaagac
ctgcggccggacgcttgcggaccggtcaaagagccccctgaaatcaatttagttttgtac
cctcaaggcctaactggtgaagaagtatatgtaaaagtggatttgagggttaaatgccca
cctacctatccagatgtagttcctgaaatagagttaaaaaatgccaaaggtctatcaaat
gaaagtgtcaatttgttaaaatctcgcctagaagaactggccaagaaacactgtggggag
gtgatgatctttgaactggcttaccacgtgcagtcatttctcagcgagcataacaagccc
cctcccaagtcttttcatgaagaaatgctggaaaggcgggctcaggaggagcagcagagg
ctgttggaggccaagcggaaagaagagcaggagcaacgtgaaatcctgcatgagattcag
agaaggaaagaagagataaaagaagagaaaaaaaggaaagaaatggctaagcaggaacgt
ttggaaattgctagtttgtcaaaccaagatcatacctctaagaaggacccaggaggacac
agaacggctgccattctacatggaggctctcctgactttgtaggaaatggtaaacatcgg
gcaaactcctcaggaaggtctaggcgagaacgtcagtattctgtatgtaatagtgaagat
tctcctggctcttgtgaaattctgtatttcaatatggggagtcctgatcagctcatggtg
cacaaagggaaatgtattggcagtgatgaacaacttggaaaattagtctacaatgctttg
gaaacagccactggtggctttgtcttgttgtatgagtgggtccttcagtggcagaaaaaa
atgggtccattccttaccagtcaagaaaaagagaagattgataagtgcaaaaagcagatt
caaggaacagaaacagaattcaactcactggtaaaattgagccatccaaatgtagtacgc
taccttgcaatgaatctcaaagagcaagacgactccatcgtggtggacattttagtggag
cacattagtggggtctctcttgctgcacacctgagccactcaggccccatccctgtgcat
cagcttcgcaggtacacagctcagctcctgtcaggccttgattatctgcacagcaattct
gtggtgcataaggtcctgagtgcatctaatgtcttggtggatgcagaaggcaccgtcaag
attacggactatagcatttctaagcgcctcgcagacatttgcaaggaggatgtgtttgag
caaacccgagttcgttttagtgacaatgctctgccttataaaacggggaagaaaggagat
gtttggcgtcttggccttctgctgctgtccctcagccaaggacaggaatgtggagagtac
cctgtgaccatccctagtgacttaccagctgactttcaagattttctaaagaaatgtgtg
tgcttggatgacaaggaaagatggagtccccagcagttgttgaaacacagctttataaat
ccccagccaaaaatgcctctagtggaacaaagtcctgaagattctgaaggacaagattat
gttgagactgttattcctagcaaccggctacccagtgctgccttctttagtgagacacag
agacagttttcccgatacttcattgagtttgaagaattacaacttcttggtaaaggagct
tttggagctgtcatcaaggtgcagaacaagttggacggctgctgctacgcagtgaagcgc
atccccatcaacccggccagccggcagttccgcaggatcaagggcgaagtgacactgctg
tcacggctgcaccatgagaacattgtgcgctactacaacgcctggatcgagcggcacgag
cggccggcgggaccggggacgccgcccccggactccgggcccctggccaaggatgaccga
gctgcacgcgggcagccggcgagcgacacagacggcctggacagcgtagaggccgccgcg
ccgccacccatcctcagcagctcggtggagtggagcacttcgggcgagcgctcggccagt
gcccgtttccccgccaccggcccgggctccagcgatgacgaggacgacgacgaggacgag
cacggtggcgtcttctcccagtccttcctgcctgcttcagattctgaaagtgatattatc
tttgacaatgaagatgagaacagtaaaagtcagaatcaggatgaagattgcaatgaaaag
aatggctgccatgaaagtgagccatcagtgacgactgaggctgtgcactacctatacatc
cagatggagtactgtgagaagagcactttacgagacaccattgaccagggactgtatcga
gacaccgtcagactctggaggctttttcgagagattctggatggattagcttatatccat
gagaaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattctgatgac
catgtgaaaataggtgattttggtttggcgacagaccatctagccttttctgctgacagc
aaacaagacgatcagacaggagacttgattaagtcagacccttcaggtcacttaactggg
atggttggcactgctctctatgtaagcccagaggtccaaggaagcaccaaatctgcatac
aaccagaaagtggatctcttcagcctgggaattatcttctttgagatgtcctatcacccc
atggtcacggcttcagaaaggatctttgttctcaaccaactcagagatcccacttcgcct
aagtttccagaagactttgacgatggagagcatgcaaagcagaaatcagtcatctcctgg
ctgttgaaccacgatccagcaaaacggcccacagccacagaactgctcaagagtgagctg
ctgcccccaccccagatggaggagtcagagctgcatgaagtgctgcaccacacgctgacc
aacgtggatgggaaggcctaccgcaccatgatggcccagatcttctcgcagcgcatctcc
cctgccatcgattacacctatgacagcgacatactgaagggcaacttctcaatccgtaca
gccaagatgcagcagcatgtgtgtgaaaccatcatccgcatctttaaaagacatggagct
gttcagttgtgtactccactactgcttccccgaaacagacaaatatatgagcacaacgaa
gctgccctattcatggaccacagcgggatgctggtgatgcttccttttgacctgcggatc
ccttttgcaagatatgtggcaagaaataatatattgaatttaaaacgatactgcatagaa
cgtgtgttcaggccgcgcaagttagatcgatttcatcccaaagaacttctggagtgtgca
tttgatattgtcacttctaccaccaacagctttctgcccactgctgaaattatctacact
atctatgaaatcatccaagagtttccagcacttcaggaaagaaattacagtatttatttg
aaccataccatgttattgaaagcaatactcttacactgtgggatcccagaagataaactc
agtcaagtctacattattctgtatgatgctgtgacagagaagctgacgaggagagaagtg
gaagctaaattttgtaatctgtctttgtcttctaatagtctgtgtcgactctacaagttt
attgaacagaagggagatttgcaagatcttatgccaacaataaattcattaataaaacag
aaaacaggtattgcacagttggtgaagtatggcttaaaagacctagaggaggttgttgga
ctgttgaagaaactcggcatcaagttacaggtcttgatcaatttgggcttggtttacaag
gtgcagcagcacaatggaatcatcttccagtttgtggctttcatcaaacgaaggcaaagg
gctgtacctgaaatcctcgcagctggaggcagatatgacctgctgattccccagtttaga
gggccacaagctctggggccagttcccactgccattggggtcagcatagctatagacaag
atatctgctgctgtcctcaacatggaggaatctgttacaataagctcttgtgacctcctg
gttgtaagtgttggccagatgtctatgtccagggccatcaacctaacccagaaactctgg
acagcaggcatcacagcagaaatcatgtacgactggtcacagtcccaagaggaattacaa
gagtactgcagacatcatgaaatcacctatgtggcccttgtctcggataaagaaggaagc
catgtcaaggttaagtctttcgagaaggaaaggcagacagagaagcgtgtgctggagact
gaacttgtggaccatgtactgcagaaactgaggactaaagtcactgatgaaaggaatggc
agagaagcttccgataatcttgcagtgcaaaatctgaaggggtcattttctaatgcttca
ggtttgtttgaaatccatggagcaacagtggttcccattgtgagtgtgctagccccggag
aagctgtcagccagcactaggaggcgctatgaaactcaggtacaaactcgacttcagacc
tcccttgccaacttacatcagaaaagcagtgaaattgaaattctggctgtggatctaccc
aaagaaacaatattacagtttttatcattagagtgggatgctgatgaacaggcatttaac
acaactgtgaagcagctgctgtcacgcctgccaaagcaaagatacctcaaattagtctgt
gatgaaatttataacatcaaagtagaaaaaaaggtgtctgtgctatttctgtacagctat
agagatgactactacagaatcttattttaa

KEGG   Homo sapiens (human): 4599Help
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA, lncMX1-215
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06166  Human papillomavirus (HPV)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
   05160 Hepatitis C
    4599 (MX1)
   05165 Human papillomavirus infection
    4599 (MX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 DUF2120 AAA_29 AAA_16 Ago_PAZ ABC_tran PP_kinase_N
Motif
Other DBs
NCBI-GeneID: 4599
NCBI-ProteinID: NP_001138397
OMIM: 147150
HGNC: 7532
Ensembl: ENSG00000157601
Vega: OTTHUMG00000086755
Pharos: P20591(Tbio)
UniProt: P20591
LinkDB All DBs
Structure
PDB: 

Position
21q22.3
AA seq 662 aa AA seqDB search
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

DBGET integrated database retrieval system