KEGG   Homo sapiens (human): 4938Help
Entry
4938              CDS       T01001                                 

Gene name
OAS1, E18/E16, IFI-4, OIAS, OIASI
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4938 (OAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4938 (OAS1)
   05164 Influenza A
    4938 (OAS1)
   05160 Hepatitis C
    4938 (OAS1)
   05168 Herpes simplex virus 1 infection
    4938 (OAS1)
   05169 Epstein-Barr virus infection
    4938 (OAS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4938 (OAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 4938
NCBI-ProteinID: NP_058132
OMIM: 164350
HGNC: 8086
Ensembl: ENSG00000089127
Vega: OTTHUMG00000169792
Pharos: P00973(Tbio)
UniProt: P00973
LinkDB All DBs
Structure
PDB: 

Position
12q24.13
AA seq 400 aa AA seqDB search
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctcagaaataccccagccaaatctctggacaagttcattgaagactatctc
ttgccagacacgtgtttccgcatgcaaatcaaccatgccattgacatcatctgtgggttc
ctgaaggaaaggtgcttccgaggtagctcctaccctgtgtgtgtgtccaaggtggtaaag
ggtggctcctcaggcaagggcaccaccctcagaggccgatctgacgctgacctggttgtc
ttcctcagtcctctcaccacttttcaggatcagttaaatcgccggggagagttcatccag
gaaattaggagacagctggaagcctgtcaaagagagagagcattttccgtgaagtttgag
gtccaggctccacgctggggcaacccccgtgcgctcagcttcgtactgagttcgctccag
ctcggggagggggtggagttcgatgtgctgcctgcctttgatgccctgggtcagttgact
ggcggctataaacctaacccccaaatctatgtcaagctcatcgaggagtgcaccgacctg
cagaaagagggcgagttctccacctgcttcacagaactacagagagacttcctgaagcag
cgccccaccaagctcaagagcctcatccgcctagtcaagcactggtaccaaaattgtaag
aagaagcttgggaagctgccacctcagtatgccctggagctcctgacggtctatgcttgg
gagcgagggagcatgaaaacacatttcaacacagcccagggatttcggacggtcttggaa
ttagtcataaactaccagcaactctgcatctactggacaaagtattatgactttaaaaac
cccattattgaaaagtacctgagaaggcagctcacgaaacccaggcctgtgatcctggac
ccggcggaccctacaggaaacttgggtggtggagacccaaagggttggaggcagctggca
caagaggctgaggcctggctgaattacccatgctttaagaattgggatgggtccccagtg
agctcctggattctgctggctgaaagcaacagtgcagacgatgagaccgacgatcccagg
aggtatcagaaatatggttacattggaacacatgagtaccctcatttctctcatagaccc
agcacactccaggcagcatccaccccacaggcagaagaggactggacctgcaccatcctc
tga

KEGG   Homo sapiens (human): 4939Help
Entry
4939              CDS       T01001                                 

Gene name
OAS2
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 2
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4939 (OAS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4939 (OAS2)
   05164 Influenza A
    4939 (OAS2)
   05160 Hepatitis C
    4939 (OAS2)
   05168 Herpes simplex virus 1 infection
    4939 (OAS2)
   05169 Epstein-Barr virus infection
    4939 (OAS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4939 (OAS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Motif
Other DBs
NCBI-GeneID: 4939
NCBI-ProteinID: NP_058197
OMIM: 603350
HGNC: 8087
Ensembl: ENSG00000111335
Vega: OTTHUMG00000169802
Pharos: P29728(Tbio)
UniProt: P29728
LinkDB All DBs
Position
12q24.13
AA seq 719 aa AA seqDB search
MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIG
GSYGRKTVLRGNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEI
QKSLDGFTIQVFTKNQRISFEVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVC
FTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYALELLTVYAWEQGCRKD
NFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNN
VSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNK
CFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS
YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSF
DVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLK
DLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVT
QYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEA
KEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggggagtcccagctgtcctcggtgcctgctcagaagctgggttggtttatc
caggaatacctgaagccctacgaagaatgtcagacactgatcgacgagatggtgaacacc
atctgtgacgtcctgcaggaacccgaacagttccccctggtgcagggagtggccataggt
ggctcctatggacggaaaacagtcttaagaggcaactccgatggtacccttgtcctcttc
ttcagtgacttaaaacaattccaggatcagaagagaagccaacgtgacatcctcgataaa
actggggataagctgaagttctgtctgttcacgaagtggttgaaaaacaatttcgagatc
cagaagtcccttgatgggttcaccatccaggtgttcacaaaaaatcagagaatctctttc
gaggtgctggccgccttcaacgctctgagcttaaatgataatcccagcccctggatctat
cgagagctcaaaagatccttggataagacaaatgccagtcctggtgagtttgcagtctgc
ttcactgaactccagcagaagttttttgacaaccgtcctggaaaactaaaggatttgatc
ctcttgataaagcactggcatcaacagtgccagaaaaaaatcaaggatttaccctcgctg
tctccgtatgccctggagctgcttacggtgtatgcctgggaacaggggtgcagaaaagac
aactttgacattgctgaaggcgtcagaaccgtactggagctgatcaaatgccaggagaag
ctgtgtatctattggatggtcaactacaactttgaagatgagaccatcaggaacatcctg
ctgcaccagctccaatcagcgaggccagtaatcttggatccagttgacccaaccaataat
gtgagtggagataaaatatgctggcaatggctgaaaaaagaagctcaaacctggttgact
tctcccaacctggataatgagttacctgcaccatcttggaatgttctgcctgcaccactc
ttcacgaccccaggccaccttctggataagttcatcaaggagtttctccagcccaacaaa
tgcttcctagagcagattgacagtgctgttaacatcatccgtacattccttaaagaaaac
tgcttccgacaatcaacagccaagatccagattgtccggggaggatcaaccgccaaaggc
acagctctgaagactggctctgatgccgatctcgtcgtgttccataactcacttaaaagc
tacacctcccaaaaaaacgagcggcacaaaatcgtcaaggaaatccatgaacagctgaaa
gccttttggagggagaaggaggaggagcttgaagtcagctttgagcctcccaagtggaag
gctcccagggtgctgagcttctctctgaaatccaaagtcctcaacgaaagtgtcagcttt
gatgtgcttcctgcctttaatgcactgggtcagctgagttctggctccacacccagcccc
gaggtttatgcagggctcattgatctgtataaatcctcggacctcccgggaggagagttt
tctacctgtttcacagtcctgcagcgaaacttcattcgctcccggcccaccaaactaaag
gatttaattcgcctggtgaagcactggtacaaagagtgtgaaaggaaactgaagccaaag
gggtctttgcccccaaagtatgccttggagctgctcaccatctatgcctgggagcagggg
agtggagtgccggattttgacactgcagaaggtttccggacagtcctggagctggtcaca
caatatcagcagctctgcatcttctggaaggtcaattacaactttgaagatgagaccgtg
aggaagtttctactgagccagttgcagaaaaccaggcctgtgatcttggacccagccgaa
cccacaggtgacgtgggtggaggggaccgttggtgttggcatcttctggcaaaagaagca
aaggaatggttatcctctccctgcttcaaggatgggactggaaacccaataccaccttgg
aaagtgccgacaatgcagacaccaggaagttgtggagctaggatccatcctattgtcaat
gagatgttctcatccagaagccatagaatcctgaataataattctaaaagaaacttctag

KEGG   Homo sapiens (human): 4940Help
Entry
4940              CDS       T01001                                 

Gene name
OAS3, p100, p100OAS
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4940 (OAS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4940 (OAS3)
   05164 Influenza A
    4940 (OAS3)
   05160 Hepatitis C
    4940 (OAS3)
   05168 Herpes simplex virus 1 infection
    4940 (OAS3)
   05169 Epstein-Barr virus infection
    4940 (OAS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4940 (OAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Motif
Other DBs
NCBI-GeneID: 4940
NCBI-ProteinID: NP_006178
OMIM: 603351
HGNC: 8088
Ensembl: ENSG00000111331
Vega: OTTHUMG00000169795
Pharos: Q9Y6K5(Tbio)
UniProt: Q9Y6K5
LinkDB All DBs
Structure
PDB: 

Position
12q24.13
AA seq 1087 aa AA seqDB search
MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKG
GSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTF
PEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEH
AACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQG
CKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPAD
PTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLD
PNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFL
NCFTDYKDQGPRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSW
TDVSLLPAFDAVGQLSSGTKPNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKN
LILLVKHWYRQVAAQNKGKGPAPASLPPAYALELLTIFAWEQGCRQDCFNMAQGFRTVLG
LVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLDPADPTWNVGHGSWELLAQEA
AALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFLAQVNKAVDTI
CSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLV
SGSRPSSQVYVDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKIS
KGRGSLPPQHGLELLTVYAWEQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKD
KTVGDFLKQQLQKPRPIILDPADPTGNLGHNARWDLLAKEAAACTSALCCMGRNGIPIQP
WPVKAAV
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagcaccccggccgctgcgctggacaggttcgtggccagaaggctgcag
ccgcggaaggagttcgtagagaaggcgcggcgcgctctgggcgccctggccgctgccctg
agggagcgcgggggccgcctcggtgctgctgccccgcgggtgctgaaaactgtcaaggga
ggctcctcgggccggggcacagctctcaagggtggctgtgattctgaacttgtcatcttc
ctcgactgcttcaagagctatgtggaccagagggcccgccgtgcagagatcctcagtgag
atgcgggcatcgctggaatcctggtggcagaacccagtccctggtctgagactcacgttt
cctgagcagagcgtgcctggggccctgcagttccgcctgacatccgtagatcttgaggac
tggatggatgttagcctggtgcctgccttcaatgtcctgggtcaggccggctccggcgtc
aaacccaagccacaagtctactctaccctcctcaacagtggctgccaagggggcgagcat
gcggcctgcttcacagagctgcggaggaactttgtgaacattcgcccagccaagttgaag
aacctaatcttgctggtgaagcactggtaccaccaggtgtgcctacaggggttgtggaag
gagacgctgcccccggtctatgccctggaattgctgaccatcttcgcctgggagcagggc
tgtaagaaggatgctttcagcctagccgaaggcctccgaactgtcctgggcctgatccaa
cagcatcagcacctgtgtgttttctggactgtcaactatggcttcgaggaccctgcagtt
gggcagttcttgcagcggcagcttaagagacccaggcctgtgatcctggacccagctgac
cccacatgggacctggggaatggggcagcctggcactgggatttgctagcccaggaggca
gcatcctgctatgaccacccatgctttctgagggggatgggggacccagtgcagtcttgg
aaggggccgggccttccacgtgctggatgctcaggtttgggccaccccatccagctagac
cctaaccagaagacccctgaaaacagcaagagcctcaatgctgtgtacccaagagcaggg
agcaaacctccctcatgcccagctcctggccccactggggcagccagcatcgtcccctct
gtgccgggaatggccttggacctgtctcagatccccaccaaggagctggaccgcttcatc
caggaccacctgaagccgagcccccagttccaggagcaggtgaaaaaggccattgacatc
atcttgcgctgcctccatgagaactgtgttcacaaggcctcaagagtcagtaaagggggc
tcatttggccggggcacagacctaagggatggctgtgatgttgaactcatcatcttcctc
aactgcttcacggactacaaggaccaggggccccgccgcgcagagatccttgatgagatg
cgagcgcagctagaatcctggtggcaggaccaggtgcccagcctgagccttcagtttcct
gagcagaatgtgcctgaggctctgcagttccagctggtgtccacagccctgaagagctgg
acggatgttagcctgctgcctgccttcgatgctgtggggcagctcagttctggcaccaaa
ccaaatccccaggtctactcgaggctcctcaccagtggctgccaggagggcgagcataag
gcctgcttcgcagagctgcggaggaacttcatgaacattcgccctgtcaagctgaagaac
ctgattctgctggtgaagcactggtaccgccaggttgcggctcagaacaaaggaaaagga
ccagcccctgcctctctgcccccagcctatgccctggagctcctcaccatctttgcctgg
gagcagggctgcaggcaggattgtttcaacatggcccaaggcttccggacggtgctgggg
ctcgtgcaacagcatcagcagctctgtgtctactggacggtcaactatagcactgaggac
ccagccatgagaatgcaccttcttggccagcttcgaaaacccagacccctggtcctggac
cccgctgatcccacctggaacgtgggccacggtagctgggagctgttggcccaggaagca
gcagcgctggggatgcaggcctgctttctgagtagagacgggacatctgtgcagccctgg
gatgtgatgccagccctcctttaccaaaccccagctggggaccttgacaagttcatcagt
gaatttctccagcccaaccgccagttcctggcccaggtgaacaaggccgttgataccatc
tgttcatttttgaaggaaaactgcttccggaattctcccatcaaagtgatcaaggtggtc
aagggtggctcttcagccaaaggcacagctctgcgaggccgctcagatgccgacctcgtg
gtgttcctcagctgcttcagccagttcactgagcagggcaacaagcgggccgagatcatc
tccgagatccgagcccagctggaggcatgtcaacaggagcggcagttcgaggtcaagttt
gaagtctccaaatgggagaatccccgcgtgctgagcttctcactgacatcccagacgatg
ctggaccagagtgtggactttgatgtgctgccagcctttgacgccctaggccagctggtc
tctggctccaggcccagctctcaagtctacgtcgacctcatccacagctacagcaatgcg
ggcgagtactccacctgcttcacagagctacaacgggacttcatcatctctcgccctacc
aagctgaagagcctgatccggctggtgaagcactggtaccagcagtgtaccaagatctcc
aaggggagaggctccctacccccacagcacgggctggaactcctgactgtgtatgcctgg
gagcagggcgggaaggactcccagttcaacatggctgagggcttccgcacggtcctggag
ctggtcacccagtaccgccagctctgtatctactggaccatcaactacaacgccaaggac
aagactgttggagacttcctgaaacagcagcttcagaagcccaggcctatcatcctggat
ccggctgacccgacaggcaacctgggccacaatgcccgctgggacctgctggccaaggaa
gctgcagcctgcacatctgccctgtgctgcatgggacggaatggcatccccatccagcca
tggccagtgaaggctgctgtgtga

KEGG   Homo sapiens (human): 4599Help
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA, lncMX1-215
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06166  Human papillomavirus (HPV)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
   05160 Hepatitis C
    4599 (MX1)
   05165 Human papillomavirus infection
    4599 (MX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 DUF2120 AAA_29 AAA_16 Ago_PAZ ABC_tran PP_kinase_N
Motif
Other DBs
NCBI-GeneID: 4599
NCBI-ProteinID: NP_001138397
OMIM: 147150
HGNC: 7532
Ensembl: ENSG00000157601
Vega: OTTHUMG00000086755
Pharos: P20591(Tbio)
UniProt: P20591
LinkDB All DBs
Structure
PDB: 

Position
21q22.3
AA seq 662 aa AA seqDB search
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

DBGET integrated database retrieval system