KEGG   Homo sapiens (human): 4940Help
Entry
4940              CDS       T01001                                 

Gene name
OAS3, p100, p100OAS
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06137  OAS/RNase L pathway (viruses)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00273  HCV NS5A to oligoadenylate synthetase (OAS)/RNase L pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00515  Oligoadenylate synthetase (OAS)/RNase L pathway
N00574  HSV US11 to oligoadenylate synthetase (OAS)/RNase L pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00724  IAV NS1 to oligoadenylate synthetase (OAS)/RNase L pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    4940 (OAS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4940 (OAS3)
   05164 Influenza A
    4940 (OAS3)
   05160 Hepatitis C
    4940 (OAS3)
   05168 Herpes simplex virus 1 infection
    4940 (OAS3)
   05169 Epstein-Barr virus infection
    4940 (OAS3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     4940 (OAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Motif
Other DBs
NCBI-GeneID: 4940
NCBI-ProteinID: NP_006178
OMIM: 603351
HGNC: 8088
Ensembl: ENSG00000111331
Vega: OTTHUMG00000169795
Pharos: Q9Y6K5(Tbio)
UniProt: Q9Y6K5
LinkDB All DBs
Structure
PDB: 

Position
12q24.13
AA seq 1087 aa AA seqDB search
MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKG
GSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTF
PEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEH
AACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQG
CKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPAD
PTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLD
PNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFL
NCFTDYKDQGPRRAEILDEMRAQLESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSW
TDVSLLPAFDAVGQLSSGTKPNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKN
LILLVKHWYRQVAAQNKGKGPAPASLPPAYALELLTIFAWEQGCRQDCFNMAQGFRTVLG
LVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLDPADPTWNVGHGSWELLAQEA
AALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFLAQVNKAVDTI
CSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLV
SGSRPSSQVYVDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKIS
KGRGSLPPQHGLELLTVYAWEQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKD
KTVGDFLKQQLQKPRPIILDPADPTGNLGHNARWDLLAKEAAACTSALCCMGRNGIPIQP
WPVKAAV
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagcaccccggccgctgcgctggacaggttcgtggccagaaggctgcag
ccgcggaaggagttcgtagagaaggcgcggcgcgctctgggcgccctggccgctgccctg
agggagcgcgggggccgcctcggtgctgctgccccgcgggtgctgaaaactgtcaaggga
ggctcctcgggccggggcacagctctcaagggtggctgtgattctgaacttgtcatcttc
ctcgactgcttcaagagctatgtggaccagagggcccgccgtgcagagatcctcagtgag
atgcgggcatcgctggaatcctggtggcagaacccagtccctggtctgagactcacgttt
cctgagcagagcgtgcctggggccctgcagttccgcctgacatccgtagatcttgaggac
tggatggatgttagcctggtgcctgccttcaatgtcctgggtcaggccggctccggcgtc
aaacccaagccacaagtctactctaccctcctcaacagtggctgccaagggggcgagcat
gcggcctgcttcacagagctgcggaggaactttgtgaacattcgcccagccaagttgaag
aacctaatcttgctggtgaagcactggtaccaccaggtgtgcctacaggggttgtggaag
gagacgctgcccccggtctatgccctggaattgctgaccatcttcgcctgggagcagggc
tgtaagaaggatgctttcagcctagccgaaggcctccgaactgtcctgggcctgatccaa
cagcatcagcacctgtgtgttttctggactgtcaactatggcttcgaggaccctgcagtt
gggcagttcttgcagcggcagcttaagagacccaggcctgtgatcctggacccagctgac
cccacatgggacctggggaatggggcagcctggcactgggatttgctagcccaggaggca
gcatcctgctatgaccacccatgctttctgagggggatgggggacccagtgcagtcttgg
aaggggccgggccttccacgtgctggatgctcaggtttgggccaccccatccagctagac
cctaaccagaagacccctgaaaacagcaagagcctcaatgctgtgtacccaagagcaggg
agcaaacctccctcatgcccagctcctggccccactggggcagccagcatcgtcccctct
gtgccgggaatggccttggacctgtctcagatccccaccaaggagctggaccgcttcatc
caggaccacctgaagccgagcccccagttccaggagcaggtgaaaaaggccattgacatc
atcttgcgctgcctccatgagaactgtgttcacaaggcctcaagagtcagtaaagggggc
tcatttggccggggcacagacctaagggatggctgtgatgttgaactcatcatcttcctc
aactgcttcacggactacaaggaccaggggccccgccgcgcagagatccttgatgagatg
cgagcgcagctagaatcctggtggcaggaccaggtgcccagcctgagccttcagtttcct
gagcagaatgtgcctgaggctctgcagttccagctggtgtccacagccctgaagagctgg
acggatgttagcctgctgcctgccttcgatgctgtggggcagctcagttctggcaccaaa
ccaaatccccaggtctactcgaggctcctcaccagtggctgccaggagggcgagcataag
gcctgcttcgcagagctgcggaggaacttcatgaacattcgccctgtcaagctgaagaac
ctgattctgctggtgaagcactggtaccgccaggttgcggctcagaacaaaggaaaagga
ccagcccctgcctctctgcccccagcctatgccctggagctcctcaccatctttgcctgg
gagcagggctgcaggcaggattgtttcaacatggcccaaggcttccggacggtgctgggg
ctcgtgcaacagcatcagcagctctgtgtctactggacggtcaactatagcactgaggac
ccagccatgagaatgcaccttcttggccagcttcgaaaacccagacccctggtcctggac
cccgctgatcccacctggaacgtgggccacggtagctgggagctgttggcccaggaagca
gcagcgctggggatgcaggcctgctttctgagtagagacgggacatctgtgcagccctgg
gatgtgatgccagccctcctttaccaaaccccagctggggaccttgacaagttcatcagt
gaatttctccagcccaaccgccagttcctggcccaggtgaacaaggccgttgataccatc
tgttcatttttgaaggaaaactgcttccggaattctcccatcaaagtgatcaaggtggtc
aagggtggctcttcagccaaaggcacagctctgcgaggccgctcagatgccgacctcgtg
gtgttcctcagctgcttcagccagttcactgagcagggcaacaagcgggccgagatcatc
tccgagatccgagcccagctggaggcatgtcaacaggagcggcagttcgaggtcaagttt
gaagtctccaaatgggagaatccccgcgtgctgagcttctcactgacatcccagacgatg
ctggaccagagtgtggactttgatgtgctgccagcctttgacgccctaggccagctggtc
tctggctccaggcccagctctcaagtctacgtcgacctcatccacagctacagcaatgcg
ggcgagtactccacctgcttcacagagctacaacgggacttcatcatctctcgccctacc
aagctgaagagcctgatccggctggtgaagcactggtaccagcagtgtaccaagatctcc
aaggggagaggctccctacccccacagcacgggctggaactcctgactgtgtatgcctgg
gagcagggcgggaaggactcccagttcaacatggctgagggcttccgcacggtcctggag
ctggtcacccagtaccgccagctctgtatctactggaccatcaactacaacgccaaggac
aagactgttggagacttcctgaaacagcagcttcagaagcccaggcctatcatcctggat
ccggctgacccgacaggcaacctgggccacaatgcccgctgggacctgctggccaaggaa
gctgcagcctgcacatctgccctgtgctgcatgggacggaatggcatccccatccagcca
tggccagtgaaggctgctgtgtga

DBGET integrated database retrieval system