KEGG   Homo sapiens (human): 494551
Entry
494551            CDS       T01001                                 

Gene name
WEE2, OOMD5, WEE1B
Definition
(RefSeq) WEE2 oocyte meiosis inhibiting kinase
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    494551 (WEE2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    494551 (WEE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    494551 (WEE2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    494551 (WEE2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     494551 (WEE2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  WEE family
   494551 (WEE2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    494551 (WEE2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 494551
NCBI-ProteinID: NP_001099028
OMIM: 614084
HGNC: 19684
Ensembl: ENSG00000214102
Vega: OTTHUMG00000157536
Pharos: P0C1S8(Tbio)
UniProt: P0C1S8
LinkDB
Structure
PDB: 
5VDK

Position
7q34
AA seq 567 aa
MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPL
SNVHELDTSSEKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRL
VISPTGKLPSRGPKHLKLTPAPLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDL
EEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAI
KRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAA
ISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIE
EVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAAL
ARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTG
SRSTKRLVGGKSARSSSFTSGEREPLH
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggatgacaaagatattgacaaagaactaaggcagaaattaaacttttcctattgtgag
gagactgagattgaagggcagaagaaagtagaagaaagcagggaggcttcgagccaaacc
ccagagaagggtgaagtgcaggattcagaggcaaagggtacaccaccttggactcccctt
agcaacgtgcatgagctcgacacatcttcggaaaaagacaaagaaagtccagatcagatt
ttgaggactccagtgtcacaccctctcaaatgtcctgagacaccagcccaaccagacagc
aggagcaagctgctgcccagtgacagcccctctactcccaaaaccatgctgagccggttg
gtgatttctccaacagggaagcttccttccagaggccctaagcatttgaagctcacacct
gctcccctcaaggatgagatgacctcattggctctggtcaatattaatcccttcactcca
gagtcctataaaaaattatttcttcaatctggtggcaagaggaaaataagaggagatctt
gaggaagctggtccagaggaaggcaagggagggctgcctgccaagagatgtgttttacga
gaaaccaacatggcttcccgctatgaaaaagaattcttggaggttgaaaaaattggggtt
ggcgaatttggtacagtctacaagtgcattaagaggctggatggatgtgtttatgcaata
aagcgctctatgaaaacttttacagaattatcaaatgagaattcggctttgcatgaagtt
tatgctcacgcagtgcttgggcatcacccccatgtggtacgttactattcctcatgggca
gaagatgaccacatgatcattcagaatgaatactgcaatggtgggagtttgcaagctgct
atatctgaaaacactaagtctggcaatcattttgaagagccaaaactcaaggacatcctt
ctacagatttcccttggccttaattacatccacaactctagcatggtacacctggacatc
aaacctagtaatatattcatttgtcacaagatgcaaagtgaatcctctggagtcatagaa
gaagttgaaaatgaagctgattggtttctctctgccaatgtgatgtataaaattggtgac
ctgggccacgcaacatcaataaacaaacccaaagtggaagaaggagatagtcgcttcctg
gctaatgagattttgcaagaggattaccggcaccttcccaaagcagacatatttgccttg
ggattaacaattgcagtggctgcaggagcagagtcattgcccaccaatggtgctgcatgg
caccatatccgcaagggtaactttccggacgttcctcaggagctctcagaaagcttttcc
agtctgctcaagaacatgatccaacctgatgccgaacagagaccttctgcagcagctctg
gccagaaatacagttctccggccttccctgggaaaaacagaagagctccaacagcagctg
aatttggaaaagttcaagactgccacactggaaagggaactgagagaagcccagcaggcc
cagtcaccccagggatatacccatcatggtgacactggggtctctgggacccacacagga
tcaagaagcacaaaacgcctggtgggaggaaagagtgcaaggtcttcaagctttacctca
ggagagcgtgagcctctgcattaa

KEGG   Homo sapiens (human): 7465
Entry
7465              CDS       T01001                                 

Gene name
WEE1, WEE1A, WEE1hu
Definition
(RefSeq) WEE1 G2 checkpoint kinase
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00459  WEE1-Cell cycle G2/M
N00460  HIV Vpr to WEE1-cell cycle G2M
Drug target
Adavosertib: D11361
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7465 (WEE1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7465 (WEE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7465 (WEE1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7465 (WEE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7465 (WEE1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  WEE family
   7465 (WEE1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    7465 (WEE1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 7465
NCBI-ProteinID: NP_003381
OMIM: 193525
HGNC: 12761
Ensembl: ENSG00000166483
Vega: OTTHUMG00000165863
Pharos: P30291(Tchem)
UniProt: P30291 Q86V29
LinkDB
Structure
PDB: 

Position
11p15.4
AA seq 646 aa
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagcttcctgagccgacagcagccgccgccaccccgccgcgccggggcggcctgcacc
ttgcggcagaagctgatcttctcgccctgcagcgactgtgaggaggaggaagaagaggag
gaggaggagggcagcggccacagcaccggggaggactcggcctttcaagagcccgactcg
ccgctgccgcccgcgcggagccccacggagcccgggcccgagcgccgccgctcgcccggg
ccggcccccggcagccccggcgagctggaggaggacctgttgctgcccggcgcctgcccg
ggcgcggacgaggcgggcggtggggcggagggcgactcgtgggaggaggagggcttcggc
tcctcgtcgccggtcaagtcgccggcggccccctacttcctgggtagctctttctcgccg
gtgcgctgcggcggcccaggagatgcgtcgccgcggggttgcggggcgcgccgggcgggc
gaaggccgccgctcgccgcggccggaccacccgggcaccccgccacacaagaccttccgc
aagctgcgactcttcgacaccccgcacacgcccaagagtttgctctccaaagctcgggga
attgattccagctctgttaaactccggggtagttctctcttcatggatacagaaaaatca
ggaaaaagggaatttgatgtgcgacagactcctcaagtgaatattaatccttttactccg
gattctttgttgcttcattcctcaggacagtgtcgtcgtagaaagagaacgtattggaat
gattcctgtggtgaagacatggaagccagtgattatgagcttgaagatgaaacaagacct
gctaagagaattacaattactgaaagcaatatgaagtcccggtatacaacagaatttcat
gagctagagaaaatcggctctggagaatttggttctgtatttaagtgtgtgaagaggctg
gatggatgcatttatgccattaagcgatcaaaaaagccattggcgggctctgttgatgag
cagaacgctttgagagaagtatatgctcatgcagtgcttggacagcattctcatgtagtt
cgatatttctctgcgtgggcagaagatgatcatatgcttatacagaatgaatattgtaat
ggtggaagtttagctgatgctataagtgaaaactacagaatcatgagttactttaaagaa
gcagagttgaaggatctccttttgcaagttggccgaggcttgaggtatattcattcaatg
tctttggttcacatggatataaaacctagtaatattttcatatctcgaacctcaatccca
aatgctgcctctgaagaaggagacgaagatgattgggcatccaacaaagttatgtttaaa
ataggtgatcttgggcatgtaacaaggatctccagtccacaagttgaagagggcgatagt
cgttttcttgcaaatgaagttttacaggagaattatacccatctaccaaaagcagatatt
tttgcgcttgccctcacagtggtatgtgctgctggtgctgaacctcttccgagaaatgga
gatcaatggcatgaaatcagacagggtagattacctcggataccacaagtgctttcccaa
gaatttacagagttgctaaaagttatgattcatccagatccagagagaagaccttcagca
atggcactggtaaagcattcagtattgctgtccgcttctagaaagagtgcagaacaatta
cgaatagaattgaatgccgaaaagttcaaaaattcacttttacaaaaagaactcaagaaa
gcacagatggcaaaagctgcagctgaggaaagagcactcttcactgaccggatggccact
aggtccaccacccagagtaatagaacatctcgacttattggaaagaaaatgaaccgctct
gtcagccttactatatactga

DBGET integrated database retrieval system