KEGG   Homo sapiens (human): 5020Help
Entry
5020              CDS       T01001                                 

Gene name
OXT, OT, OT-NPI, OXT-NPI
Definition
(RefSeq) oxytocin/neurophysin I prepropeptide
  KO
K05243  oxytocin-neurophysin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5020 (OXT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5020 (OXT)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    5020 (OXT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 5020
NCBI-ProteinID: NP_000906
OMIM: 167050
HGNC: 8528
Ensembl: ENSG00000101405
Vega: OTTHUMG00000031724
Pharos: P01178(Tbio)
CPD: C16077 C00746
UniProt: P01178 X5D7M6
LinkDB All DBs
Position
20p13
AA seq 125 aa AA seqDB search
MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
EELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEA
TFSQR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccggccccagcctcgcttgctgtctgctcggcctcctggcgctgacctccgcctgc
tacatccagaactgccccctgggaggcaagagggccgcgccggacctcgacgtgcgcaag
tgcctcccctgcggccccgggggcaaaggccgctgcttcgggcccaatatctgctgcgcg
gaagagctgggctgcttcgtgggcaccgccgaagcgctgcgctgccaggaggagaactac
ctgccgtcgccctgccagtccggccagaaggcgtgcgggagcgggggccgctgcgcggtc
ttgggcctctgctgcagcccggacggctgccacgccgaccctgcctgcgacgcggaagcc
accttctcccagcgctga

DBGET integrated database retrieval system