KEGG   Homo sapiens (human): 5023Help
Entry
5023              CDS       T01001                                 

Gene name
P2RX1, P2X1
Definition
(RefSeq) purinergic receptor P2X 1
  KO
K05215  P2X purinoceptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5023 (P2RX1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5023 (P2RX1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5023 (P2RX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    5023 (P2RX1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   5023 (P2RX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor
Motif
Other DBs
NCBI-GeneID: 5023
NCBI-ProteinID: NP_002549
OMIM: 600845
HGNC: 8533
Ensembl: ENSG00000108405
Vega: OTTHUMG00000177673
Pharos: P51575(Tchem)
UniProt: P51575
LinkDB All DBs
Position
17p13.2
AA seq 399 aa AA seqDB search
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSG
LISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEH
PEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLR
EAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESG
QNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVEN
GTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKR
HYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcggttccaggaggagctggccgccttcctcttcgagtatgacaccccccgc
atggtgctggtgcgtaataagaaggtgggcgttatcttccgactgatccagctggtggtc
ctggtctacgtcatcgggtgggtgtttctctatgagaagggctaccagacctcgagcggc
ctcatcagcagtgtctctgtgaaactcaagggcctggccgtgacccagctccctggcctc
ggcccccaggtctgggatgtggctgactacgtcttcccagcccagggggacaactccttc
gtggtcatgaccaatttcatcgtgaccccgaagcagactcaaggctactgcgcagagcac
ccagaagggggcatatgcaaggaagacagtggctgtacccctgggaaggccaagaggaag
gcccaaggcatccgcacgggcaagtgtgtggccttcaacgacactgtgaagacgtgtgag
atctttggctggtgccccgtggaggtggatgacgacatcccgcgccctgcccttctccga
gaggccgagaacttcactcttttcatcaagaacagcatcagctttccacgcttcaaggtc
aacaggcgcaacctggtggaggaggtgaatgctgcccacatgaagacctgcctctttcac
aagaccctgcaccccctgtgcccagtcttccagcttggctacgtggtgcaagagtcaggc
cagaacttcagcaccctggctgagaagggtggagtggttggcatcaccatcgactggcac
tgtgacctggactggcacgtacggcactgcagacccatctatgagttccatgggctgtac
gaagagaaaaatctctccccaggcttcaacttcaggtttgccaggcactttgtggagaac
gggaccaactaccgtcacctcttcaaggtgtttgggattcgctttgacatcctggtggac
ggcaaggccgggaagtttgacatcatccctacaatgaccaccatcggctctggaattggc
atctttggggtggccacagttctctgtgacctgctgctgcttcacatcctgcctaagagg
cactactacaagcagaagaagttcaaatacgctgaggacatggggccaggggcggctgag
cgtgacctcgcagctaccagctccaccctgggcctgcaggagaacatgaggacatcctga

DBGET integrated database retrieval system