KEGG   Homo sapiens (human): 50604Help
Entry
50604             CDS       T01001                                 

Gene name
IL20, IL-20, IL10D, ZCYTO10
Definition
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    50604 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50604 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    50604 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    50604 (IL20)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   50604 (IL20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 Pou
Motif
Other DBs
NCBI-GeneID: 50604
NCBI-ProteinID: NP_061194
OMIM: 605619
HGNC: 6002
Ensembl: ENSG00000162891
Vega: OTTHUMG00000036456
Pharos: Q9NYY1(Tbio)
UniProt: Q9NYY1
LinkDB All DBs
Structure
PDB: 

Position
1q32.1
AA seq 176 aa AA seqDB search
MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI
DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK
KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctctagtcttgccttcagccttctctctgctgcgttttatctcctatggact
ccttccactggactgaagacactcaatttgggaagctgtgtgatcgccacaaaccttcag
gaaatacgaaatggattttctgagatacggggcagtgtgcaagccaaagatggaaacatt
gacatcagaatcttaaggaggactgagtctttgcaagacacaaagcctgcgaatcgatgc
tgcctcctgcgccatttgctaagactctatctggacagggtatttaaaaactaccagacc
cctgaccattatactctccggaagatcagcagcctcgccaattcctttcttaccatcaag
aaggacctccggctctgtcatgcccacatgacatgccattgtggggaggaagcaatgaag
aaatacagccagattctgagtcactttgaaaagctggaacctcaggcagcagttgtgaag
gctttgggggaactagacattcttctgcaatggatggaggagacagaatag

DBGET integrated database retrieval system