KEGG   Homo sapiens (human): 50616Help
Entry
50616             CDS       T01001                                 

Gene name
IL22, IL-21, IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05321  Inflammatory bowel disease (IBD)
Drug target
Fezakinumab: D09615
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    50616 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50616 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50616 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    50616 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    50616 (IL22)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   50616 (IL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL22 IL10 IL28A
Motif
Other DBs
NCBI-GeneID: 50616
NCBI-ProteinID: NP_065386
OMIM: 605330
HGNC: 14900
Ensembl: ENSG00000127318
Vega: OTTHUMG00000169119
Pharos: Q9GZX6(Tbio)
UniProt: Q9GZX6
LinkDB All DBs
Structure
PDB: 

Position
12q15
AA seq 179 aa AA seqDB search
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctgcagaaatctgtgagctctttccttatggggaccctggccaccagctgc
ctccttctcttggccctcttggtacagggaggagcagctgcgcccatcagctcccactgc
aggcttgacaagtccaacttccagcagccctatatcaccaaccgcaccttcatgctggct
aaggaggctagcttggctgataacaacacagacgttcgtctcattggggagaaactgttc
cacggagtcagtatgagtgagcgctgctatctgatgaagcaggtgctgaacttcaccctt
gaagaagtgctgttccctcaatctgataggttccagccttatatgcaggaggtggtgccc
ttcctggccaggctcagcaacaggctaagcacatgtcatattgaaggtgatgacctgcat
atccagaggaatgtgcaaaagctgaaggacacagtgaaaaagcttggagagagtggagag
atcaaagcaattggagaactggatttgctgtttatgtctctgagaaatgcctgcatttga

DBGET integrated database retrieval system