KEGG   Homo sapiens (human): 5079Help
Entry
5079              CDS       T01001                                 

Gene name
PAX5, ALL3, BSAP
Definition
(RefSeq) paired box 5
  KO
K09383  paired box protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00001  B-cell acute lymphoblastic leukemia
H00011  Lymphoplasmacytic lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5079 (PAX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5079 (PAX5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    5079 (PAX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_32 HTH_23 HTH_28 HTH_Tnp_IS1 Homeodomain
Motif
Other DBs
NCBI-GeneID: 5079
NCBI-ProteinID: NP_057953
OMIM: 167414
HGNC: 8619
Ensembl: ENSG00000196092
Vega: OTTHUMG00000019907
Pharos: Q02548(Tbio)
UniProt: Q02548
LinkDB All DBs
Structure
PDB: 

Position
9p13.2
AA seq 391 aa AA seqDB search
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA
ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS
ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV
FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRF
PNPGLLGSPYYYSAAARGAAPPAAATAYDRH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatttagagaaaaattatccgactcctcggaccagcaggacaggacatggaggagtg
aatcagcttgggggggtttttgtgaatggacggccactcccggatgtagtccgccagagg
atagtggaacttgctcatcaaggtgtcaggccctgcgacatctccaggcagcttcgggtc
agccatggttgtgtcagcaaaattcttggcaggtattatgagacaggaagcatcaagcct
ggggtaattggaggatccaaaccaaaggtcgccacacccaaagtggtggaaaaaatcgct
gaatataaacgccaaaatcccaccatgtttgcctgggagatcagggaccggctgctggca
gagcgggtgtgtgacaatgacaccgtgcctagcgtcagttccatcaacaggatcatccgg
acaaaagtacagcagccacccaaccaaccagtcccagcttccagtcacagcatagtgtcc
actggctccgtgacgcaggtgtcctcggtgagcacggattcggccggctcgtcgtactcc
atcagcggcatcctgggcatcacgtcccccagcgccgacaccaacaagcgcaagagagac
gaaggtattcaggagtctccggtgccgaacggccactcgcttccgggcagagacttcctc
cggaagcagatgcggggagacttgttcacacagcagcagctggaggtgctggaccgcgtg
tttgagaggcagcactactcagacatcttcaccaccacagagcccatcaagcccgagcag
accacagagtattcagccatggcctcgctggctggtgggctggacgacatgaaggccaat
ctggccagccccacccctgctgacatcgggagcagtgtgccaggcccgcagtcctacccc
attgtgacaggccgtgacttggcgagcacgaccctccccgggtaccctccacacgtcccc
cccgctggacagggcagctactcagcaccgacgctgacagggatggtgcctgggagtgag
ttttccgggagtccctacagccaccctcagtattcctcgtacaacgactcctggaggttc
cccaacccggggctgcttggctccccctactattatagcgctgccgcccgaggagccgcc
ccacctgcagccgccactgcctatgaccgtcactga

DBGET integrated database retrieval system