KEGG   Homo sapiens (human): 50848
Entry
50848             CDS       T01001                                 

Gene name
F11R, CD321, JAM, JAM1, JAMA, JCAM, KAT, PAM-1
Definition
(RefSeq) F11 receptor
  KO
K06089  junctional adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    50848 (F11R)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    50848 (F11R)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    50848 (F11R)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    50848 (F11R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    50848 (F11R)
CD molecules [BR:hsa04090]
 Proteins
  50848 (F11R)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Ig_6 C1-set C2-set_2 Ig_C17orf99 Adeno_E3_CR1 V-set_CD47 DUF5626
Other DBs
NCBI-GeneID: 50848
NCBI-ProteinID: NP_058642
OMIM: 605721
HGNC: 14685
Ensembl: ENSG00000158769
Vega: OTTHUMG00000028602
Pharos: Q9Y624(Tbio)
UniProt: Q9Y624 Q6FIB4
LinkDB
Structure
PDB: 
1NBQ 4ODB 3EOY

Position
1q23.3
AA seq 299 aa
MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYG
EVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVERNVGVIV
AAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
NT seq 900 nt   +upstreamnt  +downstreamnt
atggggacaaaggcgcaagtcgagaggaaactgttgtgcctcttcatattggcgatcctg
ttgtgctccctggcattgggcagtgttacagtgcactcttctgaacctgaagtcagaatt
cctgagaataatcctgtgaagttgtcctgtgcctactcgggcttttcttctccccgtgtg
gagtggaagtttgaccaaggagacaccaccagactcgtttgctataataacaagatcaca
gcttcctatgaggaccgggtgaccttcttgccaactggtatcaccttcaagtccgtgaca
cgggaagacactgggacatacacttgtatggtctctgaggaaggcggcaacagctatggg
gaggtcaaggtcaagctcatcgtgcttgtgcctccatccaagcctacagttaacatcccc
tcctctgccaccattgggaaccgggcagtgctgacatgctcagaacaagatggttcccca
ccttctgaatacacctggttcaaagatgggatagtgatgcctacgaatcccaaaagcacc
cgtgccttcagcaactcttcctatgtcctgaatcccacaacaggagagctggtctttgat
cccctgtcagcctctgatactggagaatacagctgtgaggcacggaatgggtatgggaca
cccatgacttcaaatgctgtgcgcatggaagctgtggagcggaatgtgggggtcatcgtg
gcagccgtccttgtaaccctgattctcctgggaatcttggtttttggcatctggtttgcc
tatagccgaggccactttgacagaacaaagaaagggacttcgagtaagaaggtgatttac
agccagcctagtgcccgaagtgaaggagaattcaaacagacctcgtcattcctggtgtga

DBGET integrated database retrieval system