KEGG   Homo sapiens (human): 50855Help
Entry
50855             CDS       T01001                                 

Gene name
PARD6A, PAR-6A, PAR6, PAR6C, PAR6alpha, TAX40, TIP-40
Definition
(RefSeq) par-6 family cell polarity regulator alpha
  KO
K06093  partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    50855 (PARD6A)
   04390 Hippo signaling pathway
    50855 (PARD6A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    50855 (PARD6A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    50855 (PARD6A)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    50855 (PARD6A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    50855 (PARD6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50855 (PARD6A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     50855 (PARD6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1 PDZ PDZ_6
Motif
Other DBs
NCBI-GeneID: 50855
NCBI-ProteinID: NP_058644
OMIM: 607484
HGNC: 15943
Ensembl: ENSG00000102981
Vega: OTTHUMG00000137534
Pharos: Q9NPB6(Tbio)
UniProt: Q9NPB6
LinkDB All DBs
Structure
PDB: 

Position
16q22.1
AA seq 346 aa AA seqDB search
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQ
GPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcccggccgcagaggactccggcgcgcagtcccgatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgcttcgcgctgcctcgcgcttcggtgagcggcttccag
gagttctcgcggttgctgcgggcggtgcaccagatcccgggcctggacgtgctacttggc
tatacggatgctcatggcgacctgctgcccctcaccaacgacgacagcctgcaccgggcc
ctggccagcgggcccccgccactgcgcctactggtgcagaagcgggcagaagctgactcc
agcggcctggcttttgcctccaactctctgcagcggcgcaagaaagggctcttgctgcgg
ccagtggcacccctgcgcacccggccacccttgctaatcagcctgccccaagatttccgc
caggtttcctcagtcatagacgtggacctactgcctgagacccaccgacgggtgcggctg
cacaagcatggttcagaccgccccctgggcttctacatccgagatggcatgagcgtgcgt
gtggctccccagggcctggagcgggttccaggaatcttcatctcccgcctggtacgtggg
ggtctggctgagagtacagggctgctggcggtcagtgatgagatcctcgaggtcaatggc
attgaagtagccgggaagaccttggaccaagtgacggacatgatggttgccaacagccat
aacctcattgtcactgtcaagcccgccaaccagcgcaataacgtggtgcgaggggcatct
gggcgtttgacaggtcctccctctgcagggcctgggcctgctgagcctgatagtgacgat
gacagcagtgacctggtcattgagaaccgccagcctcccagttccaatgggctgtctcag
gggcccccgtgctgggacctgcaccctggctgccgacatcctggtacccgcagctctctg
ccctccctggatgaccaggagcaggccagttctggctgggggagtcgcattcgaggagat
ggtagtggcttcagcctctga

KEGG   Homo sapiens (human): 84552Help
Entry
84552             CDS       T01001                                 

Gene name
PARD6G, PAR-6G, PAR6gamma
Definition
(RefSeq) par-6 family cell polarity regulator gamma
  KO
K06093  partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    84552 (PARD6G)
   04390 Hippo signaling pathway
    84552 (PARD6G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84552 (PARD6G)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    84552 (PARD6G)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    84552 (PARD6G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84552 (PARD6G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84552 (PARD6G)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     84552 (PARD6G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1 PDZ PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 84552
NCBI-ProteinID: NP_115899
OMIM: 608976
HGNC: 16076
Ensembl: ENSG00000178184
Vega: OTTHUMG00000132922
Pharos: Q9BYG4(Tdark)
UniProt: Q9BYG4
LinkDB All DBs
Position
18q23
AA seq 376 aa AA seqDB search
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGA
LRDEGPRRRAHLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDND
VVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSL
ALPPGGVEEHGPAVTL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaagttttcacaagtctcagaccttgcgattctacgattgcagcgcagtggaa
gtcaagagcaagtttggggcggaattccgaaggttctctctggaccgtcataagcctggg
aagtttgaagatttctacaagctggttgtgcacacccaccatatctccaacagtgatgta
actattggctatgcagatgtgcacggagacctgctgcccatcaacaatgatgacaacttc
tgcaaggcggtttctagtgcaaatcccctgctcagggtcttcatccagaaacgagaggag
gccgagcgtggcagcctcggcgcgggctcgctgtgcaggcggaggcgggcgctgggcgcg
ctgcgtgatgaaggaccccggcggcgtgcacacctggacatcggcctcccgcgcgacttc
cgccccgtatcatccatcatcgatgtggacctggtccccgagacgcaccggcgagtgcgg
ctgcaccggcacggctgcgagaagccgctgggcttctacatccgcgatggcgccagcgtg
cgcgtgaccccgcacgggctggagaaggtgcccggcatcttcatctcgcgcatggtaccc
gggggcctggcggagagcaccgggctgctggctgtgaatgacgaggtcctggaggtgaac
ggcattgaggtggccgggaagacgctggaccaggtcacggacatgatgatcgccaacagc
cacaacctcatcgtcaccgtcaagcccgccaaccagcgcaacaacgtggtgcgcggcggc
cgcgcgttgggcagctcgggaccgccctcggacggcaccgcgggcttcgtgggtcccccc
gccccgcgcgtcctgcagaacttccaccccgacgaggcggagagcgatgaggacaacgac
gtcgtcatcgagggcacactggagcctgcacgtcccccccagaccccgggcgcgcccgca
ggcagcctctcccgggtcaatggcgcgggcctggcgcagcggctgcagcgggacctggcc
ctggacggcggcctccagcggctgctcagctccctgcgggccgacccccgtcacagcctg
gcgctgccgccaggcggcgtggaggagcacgggcccgcggtcacgctctag

KEGG   Homo sapiens (human): 84612Help
Entry
84612             CDS       T01001                                 

Gene name
PARD6B, PAR6B
Definition
(RefSeq) par-6 family cell polarity regulator beta
  KO
K06093  partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    84612 (PARD6B)
   04390 Hippo signaling pathway
    84612 (PARD6B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84612 (PARD6B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    84612 (PARD6B)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    84612 (PARD6B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84612 (PARD6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84612 (PARD6B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     84612 (PARD6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1 PDZ PDZ_6
Motif
Other DBs
NCBI-GeneID: 84612
NCBI-ProteinID: NP_115910
OMIM: 608975
HGNC: 16245
Ensembl: ENSG00000124171
Vega: OTTHUMG00000032732
Pharos: Q9BYG5(Tbio)
UniProt: Q9BYG5
LinkDB All DBs
Position
20q13.13
AA seq 372 aa AA seqDB search
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQ
KLLEEDGTIITL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctgcctgggcactatggaggtgaag
agcaagtttggagctgaatttcgtcggttttcgctggaaagatcaaaacctggaaaattt
gaggagttttatggattactacaacatgttcataagatccccaatgttgacgttttggta
ggctatgcagacatccatggagacttactacctataaataatgatgataattatcacaaa
gctgtttcaacggccaatccactgcttaggatatttatacaaaagaaggaagaagcagac
tacagtgcctttggtacagacacgctaataaagaagaagaatgttttaaccaacgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagactttaga
cctgtgtcttctattatagacgtggatattctcccagaaacgcatcgtagggtacgtctt
tacaaatacggcacggagaaacccctaggattctacatccgggatggctccagtgtcagg
gtaacaccacatggcttagaaaaggttccagggatctttatatccaggcttgtcccagga
ggtctggctcaaagtacaggactattagctgttaatgatgaagttttagaagttaatggc
atagaagtttcagggaagagccttgatcaagtaacagacatgatgattgcaaatagccgt
aacctcatcataacagtgagaccggcaaaccagaggaataatgttgtgaggaacagtcgg
acttctggcagttccggtcagtctactgataacagccttcttggctacccacagcagatt
gaaccaagctttgagccagaggatgaagacagcgaagaagatgacattatcattgaagac
aatggagtgccacagcagattccaaaagctgttcctaatactgagagcctggagtcatta
acacagatagagctaagctttgagtctggacagaatggctttattccctctaatgaagtg
agcttagcagccatagcaagcagctcaaacacggaatttgaaacacatgctccagatcaa
aaactcttagaagaagatggaacaatcataacattatga

DBGET integrated database retrieval system