KEGG   Homo sapiens (human): 5087Help
Entry
5087              CDS       T01001                                 

Gene name
PBX1, CAKUHED
Definition
(RefSeq) PBX homeobox 1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
nt06310  ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00117  E2A-PBX1 fusion to transcriptional activation
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Disease
H00001  B-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    5087 (PBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5087 (PBX1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5087 (PBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5087 (PBX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, PBC
    5087 (PBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3 Sec15
Motif
Other DBs
NCBI-GeneID: 5087
NCBI-ProteinID: NP_002576
OMIM: 176310
HGNC: 8632
Ensembl: ENSG00000185630
Vega: OTTHUMG00000034307
Pharos: P40424(Tbio)
UniProt: P40424 A0A024R919 A8K5V0
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 430 aa AA seqDB search
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagcccaggctgatgcattcccatgctggggtcgggatggccggacacccc
ggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaag
caggacattggagacattttacagcaaattatgaccatcacagaccagagtttggatgag
gcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtg
ttgtgtgaaatcaaagaaaaaacagttttgagtatccgaggagcccaggaggaggaaccc
acagacccccagctgatgcggctggacaacatgctgttagcggaaggcgtggcggggcct
gagaagggcggagggtcggcggcagcggcggcagcggcggcggcttctggaggggcaggt
tcagacaactcagtggagcattcagattacagagccaaactctcacagatcagacaaatc
taccatacggagctggagaaatacgagcaggcctgcaacgagttcaccacccacgtgatg
aatctcctgcgagagcaaagccggaccaggcccatctccccaaaggagattgagcggatg
gtcagcatcatccaccgcaagttcagctccatccagatgcagctcaagcagagcacgtgc
gaggcggtgatgatcctgcgttcccgatttctggatgcgcggcggaagagacggaatttc
aacaagcaagcgacagaaatcctgaatgaatatttctattcccatctcagcaacccttac
cccagtgaggaagccaaagaggagttagccaagaagtgtggcatcacagtctcccaggta
tcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagag
gaagccaatatttatgctgccaaaacagctgtcactgctaccaatgtgtcagcccatgga
agccaagctaactcgccctcaactcccaactcggctggttcttccagttcttttaacatg
tcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggg
gcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccag
acaggaggatacagtgatggactcgcagccagtcagatgtacagtccgcagggcatcagt
gctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggc
cctggcagtgttcactctgatacctccaactga

DBGET integrated database retrieval system