KEGG   Homo sapiens (human): 51Help
Entry
51                CDS       T01001                                 

Gene name
ACOX1, ACOX, PALMCOX, SCOX
Definition
(RefSeq) acyl-CoA oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00410  beta-Alanine metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa00640  Propanoate metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04024  cAMP signaling pathway
hsa04146  Peroxisome
Module
hsa_M00087  beta-Oxidation
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
Network
nt06021  beta-Oxidation in peroxisome
  Element
N00776  beta-Oxidation, peroxisome, VLCFA
N00777  HSD17B4 deficiency in beta-oxidation
N00778  ACOX1 deficiency in beta-oxidation
Disease
H00407  Peroxisomal beta-oxidation enzyme deficiency
H02096  Peroxisomal acyl-CoA oxidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    51 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    51 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    51 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    51 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    51 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    51 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    51 (ACOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     51 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 51
NCBI-ProteinID: NP_004026
OMIM: 609751
HGNC: 119
Ensembl: ENSG00000161533
Vega: OTTHUMG00000180027
Pharos: Q15067(Tbio)
UniProt: Q15067
LinkDB All DBs
Position
17q25.1
AA seq 660 aa AA seqDB search
MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRY
EVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATAEQQ
ERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL
KMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIA
IRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIG
QGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSP
ESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFS
EKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIR
SDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggacctgcgcagggagcgggattccgccagcttcaacccggagctgcttaca
cacatcctggacggcagccccgagaaaacccggcgccgccgagagatcgagaacatgatc
ctgaacgacccagacttccagcatgaggacttgaacttcctcactcgcagccagcgttat
gaggtggctgtcaggaaaagtgccatcatggtgaagaagatgagggagtttggcatcgct
gaccctgatgaaattatgtggtttaaaaattttgtgcaccgagggcggcctgagcctctg
gatcttcacttgggcatgttcctgcccaccttgcttcaccaggcaactgcggagcagcag
gagcgcttcttcatgcccgcctggaacttggagatcattggcacttatgcccagacagag
atgggtcatggaactcaccttcgaggcttggaaaccacagccacgtatgaccctgaaacc
caggagttcattctcaacagtcctactgtgacctccattaaatggtggcctggtgggctt
ggaaagacttcaaatcatgcaatagttcttgcccagctcatcactaaggggaaatgctat
ggattacatgcctttatcgtacctattcgtgaaatcgggacccataagcctttgccagga
attaccgttggtgacatcggccccaaatttggttatgatgagatagacaatggctacctc
aaaatggacaaccatcgtattcccagagaaaacatgctgatgaagtatgcccaggtgaag
cctgatggcacatacgtgaaaccgctgagtaacaagctgacttacgggaccatggtgttt
gtcaggtccttccttgtgggagaagctgctcgggctctgtctaaggcgtgcaccattgcc
atccgatacagcgctgtgaggcaccagtctgaaatcaagccaggtgaaccagaaccacag
attttggattttcaaacccagcagtataaactctttccactcctggccactgcctatgcc
ttccagtttgtgggcgcatacatgaaggagacctatcaccggattaacgaaggcattggt
caaggggacctgagtgaactgcctgagcttcatgccctcaccgctggactgaaggctttc
acctcctggactgcaaacactggcattgaagcatgtcggatggcttgtggtgggcatggc
tattctcattgcagtggtcttccaaatatttatgtcaatttcaccccaagctgtaccttt
gagggagaaaacactgtcatgatgctccagacggctaggttcctgatgaaaagttatgat
caggtgcactcaggaaagttggtgtgtggcatggtgtcctatttgaacgacctgcccagt
cagcgcatccagccacagcaggtagcagtctggccaaccatggtggatatcaacagcccc
gaaagcctaaccgaagcatataaactccgtgcagccagattagtagaaattgctgcaaaa
aaccttcaaaaagaagtgattcacagaaaaagcaaggaggtagcttggaacctaacttct
gttgaccttgttcgagcaagtgaggcacattgccactatgtggtagttaagctcttttca
gaaaaactcctcaaaattcaagataaagccattcaagctgtcttaaggagtttatgtctg
ctgtattctctgtatggaatcagtcagaacgcgggggatttccttcaggggagcatcatg
acagagcctcagattacacaagtaaaccagcgtgtaaaggagttactcactctgattcgc
tcagatgctgttgctttggttgatgcatttgattttcaggatgtgacacttggctctgtg
cttggccgctatgatgggaatgtgtatgaaaacttgtttgagtgggctaagaactcccca
ctgaacaaagcagaggtccacgaatcttacaagcacctgaagtcactgcagtccaagctc
tga

KEGG   Homo sapiens (human): 8310Help
Entry
8310              CDS       T01001                                 

Gene name
ACOX3
Definition
(RefSeq) acyl-CoA oxidase 3, pristanoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00410  beta-Alanine metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa00640  Propanoate metabolism
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04024  cAMP signaling pathway
hsa04146  Peroxisome
Module
hsa_M00087  beta-Oxidation
hsa_M00861  beta-Oxidation, peroxisome, VLCFA
Network
nt06021  beta-Oxidation in peroxisome
  Element
N00776  beta-Oxidation, peroxisome, VLCFA
N00777  HSD17B4 deficiency in beta-oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    8310 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    8310 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    8310 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    8310 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8310 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    8310 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8310 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    8310 (ACOX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     8310 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 8310
NCBI-ProteinID: NP_003492
OMIM: 603402
HGNC: 121
Ensembl: ENSG00000087008
Vega: OTTHUMG00000090509
Pharos: O15254(Tdark)
UniProt: O15254
LinkDB All DBs
Position
4p16.1
AA seq 700 aa AA seqDB search
MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPL
FARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAK
YLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPAT
EEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMP
GVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS
LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYL
AAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQ
ECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFR
SPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSG
SSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL
SRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADG
ELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcatccactgtggaaggaggcgacacagctctgctcccagaattccccagggggccc
ctcgatgcctaccgagcaagagcgtccttcagctggaaggagctggcgctgttcacggaa
ggggagggcatgctccgctttaagaaaaccatcttctcagctcttgagaatgaccctctt
ttcgctcgttcccctggagccgatctgtccttggagaagtatcgcgagctgaacttcctt
cgatgcaagcggatcttcgagtatgacttcctcagtgtcgaagacatgttcaagagccct
ctgaaggtccccgccttgattcagtgcctgggcatgtatgactcttctctggctgccaag
tacctcctccatagcttggtttttggatcagcagtttacagttctggttctgaaagacat
ctcacatatattcaaaagatcttcaggatggagatttttggatgttttgctctgaccgaa
ttaagccacggcagtaataccaaggccattcgcacaactgcccactacgatcctgccact
gaggaattcatcatacattcccctgatttcgaagctgccaagttttgggttggcaacatg
ggcaagacagccactcacgcggtggtgtttgctaagctgtgtgtgccaggggaccagtgc
catgggctgcatccctttatcgtgcagatccgggacccgaagacccttcttcccatgcct
ggagtgatggttggcgacataggaaaaaaactcgggcagaacggtctggataatggtttc
gccatgttccacaaggtcagagttcctcgccagagccttctgaaccggatgggagacgtc
acccccgagggcacctatgtcagcccctttaaggacgtcaggcagcgctttggagcgtcc
ctggggagcctgtcctcgggccgggtctccatcgtgagcctggccatccttaacctaaag
ctggccgtggccatcgctcttcgcttctcagccactcggcgtcagtttggacccacagag
gaggaggaaataccagtgcttgagtatccaatgcagcaatggcgcttgcttccatatctg
gcagctgtctacgccttagaccatttctccaagtcgctcttcctggacctggtggagctc
cagcgaggacttgcatcgggagaccgcagcgccagacaggcagagcttggacgtgagatc
cacgccctggcatcggccagcaagcccctggcctcgtggaccacccagcaaggaattcag
gaatgccgggaggcgtgtggaggacacggctatctggccatgaaccggttgggtgtcctt
agagatgacaacgatcccaactgcacatacgaaggtgacaacaacatcctgctgcagcag
acaagcaactatttgctgggtctcctggcacaccaggtccacgatggagcttgcttccgc
agtccgctgaagtcagtggactttctggacgcctatcccggcatccttgaccagaagttt
gaggtctccagtgttgccgactgcttggactctgcagtcgccctggcagcatacaagtgg
ctggtttgctacctgctccgagagacttatcaaaaattaaaccaagagaaaagatcagga
agcagtgactttgaagcaaggaacaaatgccaggtgtcccacggccgtccgttggcgctg
gccttcgtggagctcacggtggtccagaggttccacgagcacgtgcaccagccttccgtg
ccgccctcgctgcgggccgtgctggggcggctcagtgctctgtacgccctgtggtccctg
agccgccacgcggccctgctctaccgaggaggatacttctccggtgagcaggcgggagaa
gtgttggagagcgccgtcctggctttgtgttcccagctgaaagacgatgcagttgccctg
gtagacgtgatcgctcctcctgactttgttctggactcaccgattggcagagccgacggc
gagctctacaaaaacctctggggcgctgtcctgcaggaaagcaaggtgttggagcgggca
tcctggtggccagagttttctgtgaacaaacctgtcataggaagtctgaaatcgaagctc
tag

DBGET integrated database retrieval system