KEGG   Homo sapiens (human): 51024
Entry
51024             CDS       T01001                                 

Gene name
FIS1, CGI-135, TTC11
Definition
(RefSeq) fission, mitochondrial 1
  KO
K17969  mitochondrial fission 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    51024 (FIS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51024 (FIS1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    51024 (FIS1)
SSDB
Motif
Pfam: Fis1_TPR_C Fis1_TPR_N ANAPC3 TPR_2 TPR_15 COPI_C DUF6057 DUF2481 TPR_14
Other DBs
NCBI-GeneID: 51024
NCBI-ProteinID: NP_057152
OMIM: 609003
HGNC: 21689
Ensembl: ENSG00000214253
Vega: OTTHUMG00000157106
Pharos: Q9Y3D6(Tbio)
UniProt: Q9Y3D6
LinkDB
Structure
PDB: 
1NZN 1PC2

Position
7q22.1
AA seq 152 aa
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
NT seq 459 nt   +upstreamnt  +downstreamnt
atggaggccgtgctgaacgagctggtgtctgtggaggacctgctgaagtttgaaaagaaa
tttcagtctgagaaggcagcaggctcggtgtccaagagcacgcagtttgagtacgcctgg
tgcctggtgcggagcaagtacaatgatgacatccgtaaaggcatcgtgctgctcgaggag
ctgctgcccaaagggagcaaggaggaacagcgggattacgtcttctacctggccgtgggg
aactaccggctcaaggaatacgagaaggccttaaagtacgtccgcgggttgctgcagaca
gagccccagaacaaccaggccaaggaactggagcggctcattgacaaggccatgaagaaa
gatggactcgtgggcatggccatcgtgggaggcatggccctgggtgtggcgggactggcc
ggactcatcggacttgctgtgtccaagtccaaatcctga

DBGET integrated database retrieval system