KEGG   Homo sapiens (human): 51052Help
Entry
51052             CDS       T01001                                 

Gene name
PRLH, PRH, PRRP
Definition
(RefSeq) prolactin releasing hormone
  KO
K05269  Prolactin-releasing peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51052 (PRLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prolactin_RP
Motif
Other DBs
NCBI-GeneID: 51052
NCBI-ProteinID: NP_056977
OMIM: 602663
HGNC: 17945
Ensembl: ENSG00000071677
Vega: OTTHUMG00000133296
Pharos: P81277(Tdark)
CPD: C16086 C16087
UniProt: P81277 Q53QV7
LinkDB All DBs
Position
2q37.3
AA seq 87 aa AA seqDB search
MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
GDVPKPGLRPRLTCFPLEGGAMSSQDG
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctgagggcctggctcctgtgcctgctgatgctgggcctggccctgcgggga
gctgcaagtcgtacccatcggcactccatggagatccgcacccctgacatcaatcctgcc
tggtacgccagtcgcgggatcaggcctgtgggccgcttcggtcggaggagggcaaccctg
ggggacgtccccaagcctggcctgcgaccccggctgacctgcttccccctggaaggcggt
gctatgtcgtcccaggatggctga

DBGET integrated database retrieval system