KEGG   Homo sapiens (human): 51083
Entry
51083             CDS       T01001                                 

Gene name
GAL, ETL8, GAL-GMAP, GALN, GLNN, GMAP
Definition
(RefSeq) galanin and GMAP prepropeptide
  KO
K05244  galanin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00809  Familial epilepsy temporal lobe (ETL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51083 (GAL)
SSDB
Motif
Pfam: GMAP Galanin Trypan_PARP
Other DBs
NCBI-GeneID: 51083
NCBI-ProteinID: NP_057057
OMIM: 137035
HGNC: 4114
Ensembl: ENSG00000069482
Vega: OTTHUMG00000167890
Pharos: P22466(Tbio)
CPD: C15901
UniProt: P22466
LinkDB
Position
11q13.2
AA seq 123 aa
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGL
TSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI
ERS
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcccgaggcagcgccctcctgctcgcctccctcctcctcgccgcggccctttctgcc
tctgcggggctctggtcgccggccaaggaaaaacgaggctggaccctgaacagcgcgggc
tacctgctgggcccacatgccgttggcaaccacaggtcattcagcgacaagaatggcctc
accagcaagcgggagctgcggcccgaagatgacatgaaaccaggaagctttgacaggtcc
atacctgaaaacaatatcatgcgcacaatcattgagtttctgtctttcttgcatctcaaa
gaggccggtgccctcgaccgcctcctggatctccccgccgcagcctcctcagaagacatc
gagcggtcctga

DBGET integrated database retrieval system