KEGG   Homo sapiens (human): 51084
Entry
51084             CDS       T01001                                 

Gene name
CRYL1, GDH, HEL30, gul3DH, lambda-CRY
Definition
(RefSeq) crystallin lambda 1
  KO
K13247  L-gulonate 3-dehydrogenase [EC:1.1.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa01100  Metabolic pathways
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    51084 (CRYL1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.45  L-gulonate 3-dehydrogenase
     51084 (CRYL1)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_Gly3P_dh_N Ldh_1_N AlaDh_PNT_C ApbA adh_short Pyr_redox
Other DBs
NCBI-GeneID: 51084
NCBI-ProteinID: NP_057058
OMIM: 609877
HGNC: 18246
Ensembl: ENSG00000165475
Vega: OTTHUMG00000016516
Pharos: Q9Y2S2(Tbio)
UniProt: Q9Y2S2 V9HWG2
LinkDB
Structure
PDB: 
3F3S

Position
13q12.11
AA seq 319 aa
MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAG
SLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILS
SSTSCLMPSKLFAGLVHVKQCIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIG
QCPMRVQKEVAGFVLNRLQYAIISEAWRLVEEGIVSPSDLDLVMSEGLGMRYAFIGPLET
MHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKVNQDMCMKVPDDPEHLAARRQ
WRDECLMRLAKLKSQVQPQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcgtcctccgcggccggctgcgtggtgatcgttggcagtggagtcattgggcgaagc
tgggccatgctgtttgccagtggaggcttccaggtgaaactctatgacattgagcaacag
cagataaggaacgccctggaaaacatcagaaaggagatgaagttgctggagcaggcaggt
tctctgaaaggctccctgagtgtggaagagcagctgtcactcatcagtggttgtcccaat
atccaagaagcagtagagggtgccatgcacattcaggaatgtgttccagaagatctagaa
ctgaagaagaagatttttgctcagttagattccatcattgatgatcgagtgatcttaagc
agttccacttcttgtctcatgccttccaagttgtttgctggcttggtccatgtgaagcaa
tgcatcgtggctcatcctgtgaatccgccatactacatcccgctggttgagctggtcccc
cacccggagacggcccctacgacagtggacagaacccacgccctgatgaagaagattgga
cagtgccccatgcgagtccagaaggaggtggccggcttcgttctgaaccgcctgcaatat
gcaatcatcagcgaggcctggcggctagtggaggaaggaatcgtgtctcctagtgacctg
gaccttgtcatgtcagaagggttgggcatgcggtatgcattcattggacccctggaaacc
atgcatctcaatgcagaaggtatgttaagctactgcgacagatacagcgaaggcataaaa
catgtcctacagacttttggacccattccagagttttccagggccactgctgagaaggtt
aaccaggacatgtgcatgaaggtccctgatgacccggagcacttagctgccaggaggcag
tggagggacgagtgcctcatgagactcgccaagttgaagagtcaagtgcagccccagtga

DBGET integrated database retrieval system