KEGG   Homo sapiens (human): 51094
Entry
51094             CDS       T01001                                 

Gene name
ADIPOR1, ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A
Definition
(RefSeq) adiponectin receptor 1
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    51094 (ADIPOR1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    51094 (ADIPOR1)
  09149 Aging
   04211 Longevity regulating pathway
    51094 (ADIPOR1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    51094 (ADIPOR1)
SSDB
Motif
Pfam: HlyIII DUF962 DUF4405
Other DBs
NCBI-GeneID: 51094
NCBI-ProteinID: NP_001277482
OMIM: 607945
HGNC: 24040
Ensembl: ENSG00000159346
Vega: OTTHUMG00000041391
Pharos: Q96A54(Tbio)
UniProt: Q96A54
LinkDB
Structure
PDB: 
5LXG 3WXV

Position
1q32.1
AA seq 375 aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgtggtggcacaggggaatggggctcctgccagtaacagg
gaagctgacacggtggaactggctgaactgggacccctgctagaagagaagggcaaacgg
gtaatcgccaacccacccaaagctgaagaagagcaaacatgcccagtgccccaggaagaa
gaggaggaggtgcgggtactgacacttcccctgcaagcccaccacgccatggagaagatg
gaagagtttgtgtacaaggtctgggagggacgttggagggtcatcccatatgatgtgctc
cctgactggctaaaggacaacgactatctgctacatggtcatagacctcccatgccctcc
tttcgggcttgcttcaagagcatcttccgcattcatacagaaactggcaacatctggacc
catctgcttggtttcgtgctgtttctctttttgggaatcttgaccatgctcagaccaaat
atgtacttcatggcccctctacaggagaaggtggtttttgggatgttctttttgggtgca
gtgctctgcctcagcttctcctggctctttcacaccgtctattgtcattcagagaaagtc
tctcggactttttccaaactggactattcagggattgctcttctaattatggggagcttt
gtcccctggctctattattccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatttctgccatcattgtggcgcagtgggaccggtttgccact
cctaagcaccggcagacaagagcaggcgtgttcctgggacttggcttgagtggcgtcgtg
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcactggagctggcctttatgctgctcga
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcagcctttgtccacttctatggagtctccaaccttcaggaa
ttccgttacggcctagaaggcggctgtactgatgacacccttctctga

KEGG   Homo sapiens (human): 79602
Entry
79602             CDS       T01001                                 

Gene name
ADIPOR2, ACDCR2, PAQR2
Definition
(RefSeq) adiponectin receptor 2
  KO
K07297  adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    79602 (ADIPOR2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    79602 (ADIPOR2)
  09149 Aging
   04211 Longevity regulating pathway
    79602 (ADIPOR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    79602 (ADIPOR2)
SSDB
Motif
Pfam: HlyIII PRR18
Other DBs
NCBI-GeneID: 79602
NCBI-ProteinID: NP_078827
OMIM: 607946
HGNC: 24041
Ensembl: ENSG00000006831
Vega: OTTHUMG00000130139
Pharos: Q86V24(Tbio)
UniProt: Q86V24
LinkDB
Structure
PDB: 
5LX9 5LWY 3WXW 5LXA

Position
12p13.33
AA seq 386 aa
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCSEEDAL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacgagccaacagaaaaccgattggggtgcagcaggactccagagccagatataagg
ctcagaaaagggcaccaactggatggtacacgaagaggtgataatgacagccaccaagga
gatttggagcccattttagaggcatctgttctatcttcccatcataaaaaaagctctgag
gaacatgaatacagtgatgaagctcctcaggaagatgagggctttatgggcatgtcccct
ctcttacaagcccatcatgctatggaaaaaatggaagaatttgtttgtaaggtatgggaa
ggtcggtggcgagtgatccctcatgatgtactaccagactggctcaaggataatgacttc
ctcttgcatggacaccggcctcctatgccttctttccgggcctgttttaagagcattttc
agaatacacacagaaacaggcaacatttggacacatctcttaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatctcctttgtggcccctctgcaagag
aaggtggtctttggattatttttcttaggagccattctctgcctttctttttcatggctc
ttccacacagtctactgccactcagagggggtctctcggctcttctctaaactggattac
tctggtattgctcttctgattatgggaagttttgttccttggctttattattctttctac
tgtaatccacaaccttgcttcatctacttgattgtcatctgtgtgctgggcattgcagcc
attatagtctcccagtgggacatgtttgccacccctcagtatcggggagtaagagcagga
gtgtttttgggcctaggcctgagtggaatcattcctaccttgcactatgtcatctcggag
gggttccttaaggccgccaccatagggcagataggctggttgatgctgatggccagcctc
tacatcacaggagctgccctgtatgctgcccggatccccgaacgctttttccctggcaaa
tgtgacatctggtttcactctcatcagctgtttcatatctttgtggttgctggagctttt
gttcacttccatggtgtctcaaacctccaggagtttcgtttcatgatcggcgggggctgc
agtgaagaggatgcactgtga

DBGET integrated database retrieval system