KEGG   Homo sapiens (human): 51100Help
Entry
51100             CDS       T01001                                 

Gene name
SH3GLB1, Bif-1, CGI-61, PPP1R70, dJ612B15.2
Definition
(RefSeq) SH3 domain containing GRB2 like, endophilin B1
  KO
K11248  endophilin-B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51100 (SH3GLB1)
   04140 Autophagy - animal
    51100 (SH3GLB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    51100 (SH3GLB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51100 (SH3GLB1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51100 (SH3GLB1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     51100 (SH3GLB1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    51100 (SH3GLB1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    51100 (SH3GLB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    51100 (SH3GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_9 BAR_2 BAR_3 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 51100
NCBI-ProteinID: NP_057093
OMIM: 609287
HGNC: 10833
Ensembl: ENSG00000097033
Vega: OTTHUMG00000010257
Pharos: Q9Y371(Tbio)
UniProt: Q9Y371 A0A140VJU5
LinkDB All DBs
Position
1p22.3
AA seq 365 aa AA seqDB search
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTSGLVITSPSNLSD
LKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKVPITY
LELLN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcatggacttcaacgtgaagaagctggcggccgacgcaggcaccttcctcagt
cgcgccgtgcagttcacagaagaaaagcttggccaggctgagaagacagaattggatgct
cacttagagaacctccttagcaaagctgaatgtaccaaaatatggacagaaaaaataatg
aaacaaactgaagtgttattgcagccaaatccaaatgccaggatagaagaatttgtttat
gagaaactggatagaaaagctccaagtcgtataaacaacccagaacttttgggacaatat
atgattgatgcagggactgagtttggcccaggaacagcttatggtaatgcccttattaaa
tgtggagaaacccaaaaaagaattggaacagcagacagagaactgattcaaacgtcagcc
ttaaattttcttactcctttaagaaactttatagaaggagattacaaaacaattgctaaa
gaaaggaaactattgcaaaataagagactggatttggatgctgcaaaaacgagactaaaa
aaggcaaaagctgcagaaactagaaattcatctgaacaggaattaagaataactcaaagt
gaatttgatcgtcaagcagagattaccagacttctgctagagggaatcagcagtacacat
gcccatcaccttcgctgtctgaatgactttgtagaagcccagatgacttactatgcacag
tgttaccagtatatgttggacctccagaaacaactgggaagttttccatccaattatctt
agtaacaacaatcagacttctgtgacacctgtaccatcagttttaccaaatgcgattggt
tcttctgccatggcttcaacaagtggcctagtaatcacctctccttccaacctcagtgac
cttaaggagtgtagtggcagcagaaaggccagggttctctatgattatgatgcagcaaac
agtactgaattatcacttctggcagatgaggtgatcactgtgttcagtgttgttggaatg
gattcagactggctaatgggggaaaggggaaaccagaagggcaaggtgccaattacctac
ttagaactgctcaattaa

KEGG   Homo sapiens (human): 56904Help
Entry
56904             CDS       T01001                                 

Gene name
SH3GLB2, PP6569, PP9455, RRIG1
Definition
(RefSeq) SH3 domain containing GRB2 like, endophilin B2
  KO
K21269  endophilin-B2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56904 (SH3GLB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56904 (SH3GLB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    56904 (SH3GLB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_9 SH3_2 BAR_2 SH3_1 BAR_3 IMD
Motif
Other DBs
NCBI-GeneID: 56904
NCBI-ProteinID: NP_001273975
OMIM: 609288
HGNC: 10834
Ensembl: ENSG00000148341
Vega: OTTHUMG00000020769
Pharos: Q9NR46(Tdark)
UniProt: Q9NR46 A0A024R896
LinkDB All DBs
Position
9q34.11
AA seq 395 aa AA seqDB search
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAE
AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLE
GISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTS
PTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADE
LITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaacatgaagaagctggcgtcggacgcgggcatcttcttcacccgggcggtg
cagttcacggaggagaaatttggccaggctgagaagactgagcttgatgcccactttgaa
aaccttctggcccgggcagacagcaccaagaactggacagagaagatcttgaggcagaca
gaggtgctgctgcagcccaaccccagtgcccgagtggaggagttcctgtatgagaagctg
gacaggaaggtcccctcaagggtcaccaacggggagctgctggctcagtacatggcagac
gcggccagtgagctggggccgaccaccccctatgggaagacactgatcaaggtggcagaa
gctgaaaagcaactgggagccgcggagagggattttatccacacggcctccatcagcttc
ctcacacccttgcgcaacttcctggagggggactggaagaccatctcgaaggagaggcgg
ctcctccaaaaccggcgtctggacttggatgcctgcaaagcgaggctgaagaaggccaag
gctgcagaagccaaagccacgacggtgcctgactttcaggagactagacctcgtaattac
attctctcggccagcgcctccgcgctctggaatgatgaagtggacaaggccgagcaggag
ctccgcgtggcccagacagagtttgaccggcaagcagaagtgacccgtctcttgctggag
ggaatcagtagcactcacgtgaaccacctgcgctgcctccacgagttcgtcaagtctcag
acaacctactacgcacagtgctaccgccacatgctggacttgcagaagcagctgggcaga
tttcccggcaccttcgtgggcaccacagagcccgcctccccacccctgagcagcacctca
cccaccactgctgcggccactatgcctgtggtgccctctgtggccagcctggcccctccg
ggggaggcctcgctctgcctggaagaggtggccccccctgccagtgggacccgcaaagct
cgggtgctctatgactacgaggcagccgacagcagtgagctggccctgctggctgatgag
ctcatcactgtctacagcctgcctggcatggaccctgactggctcattggcgagagaggc
aacaagaagggcaaggtccctgtcacctacttggaactgctcagctag

KEGG   Homo sapiens (human): 6455Help
Entry
6455              CDS       T01001                                 

Gene name
SH3GL1, CNSA1, EEN, SH3D2B, SH3P8
Definition
(RefSeq) SH3 domain containing GRB2 like 1, endophilin A2
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6455 (SH3GL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6455 (SH3GL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6455 (SH3GL1)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6455 (SH3GL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_1 SH3_9 SH3_2 BAR_2 BAR_3 Prefoldin_3 PhnG
Motif
Other DBs
NCBI-GeneID: 6455
NCBI-ProteinID: NP_003016
OMIM: 601768
HGNC: 10830
Ensembl: ENSG00000141985
Vega: OTTHUMG00000181918
Pharos: Q99961(Tbio)
UniProt: Q99961 Q6FGM0
LinkDB All DBs
Position
19p13.3
AA seq 368 aa AA seqDB search
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKL
KRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYV
EVLVPLPQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggcggggctgaagaagcagttctacaaggcgagccagctggtcagtgagaag
gtcggaggggccgaggggaccaagctggatgatgacttcaaagagatggagaagaaggtg
gatgtcaccagcaaggcggtgacagaagtgctggccaggaccatcgagtacctgcagccc
aacccagcctcgcgggctaagctgaccatgctcaacacggtgtccaagatccggggccag
gtgaagaaccccggctacccgcagtcggaggggcttctgggcgagtgcatgatccgccac
gggaaggagctgggcggcgagtccaactttggtgacgcattgctggatgccggcgagtcc
atgaagcgcctggcagaggtgaaggactccctggacatcgaggtcaagcagaacttcatt
gaccccctccagaacctgtgcgagaaagacctgaaggagatccagcaccacctgaagaaa
ctggagggccgccgcctggactttgactacaagaagaagcggcagggcaagatccccgat
gaggagctacgccaggcgctggagaagttcgaggagtccaaggaggtggcagaaaccagc
atgcacaacctcctggagactgacatcgagcaggtgagtcagctctcggccctggtggat
gcacagctggactaccaccggcaggccgtgcagatcctggacgagctggcggagaagctc
aagcgcaggatgcgggaagcttcctcacgccctaagcgggagtataagcccaagccccgg
gagccctttgaccttggagagcctgagcagtccaacgggggcttcccctgcaccacagcc
cccaagatcgcagcttcatcgtctttccgatcttccgacaagcccatccggacccctagc
cggagcatgccgcccctggaccagccgagctgcaaggcgctgtacgacttcgagcccgag
aacgacggggagctgggcttccatgagggcgacgtcatcacgctgaccaaccagatcgat
gagaactggtacgagggcatgctggacggccagtcgggcttcttcccgctcagctacgtg
gaggtgcttgtgcccctgccgcagtga

KEGG   Homo sapiens (human): 6456Help
Entry
6456              CDS       T01001                                 

Gene name
SH3GL2, CNSA2, EEN-B1, SH3D2A, SH3P4
Definition
(RefSeq) SH3 domain containing GRB2 like 2, endophilin A1
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6456 (SH3GL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6456 (SH3GL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6456 (SH3GL2)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6456 (SH3GL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_2 SH3_1 SH3_9 BAR_2 BAR_3 DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 6456
NCBI-ProteinID: NP_003017
OMIM: 604465
HGNC: 10831
Ensembl: ENSG00000107295
Vega: OTTHUMG00000019601
Pharos: Q99962(Tbio)
UniProt: Q99962 Q7Z376
LinkDB All DBs
Structure
PDB: 

Position
9p22.2
AA seq 352 aa AA seqDB search
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggccggcctcaagaagcagttccataaagccactcagaaagtgagtgagaag
gttggaggagctgaaggaaccaagctagatgatgacttcaaagagatggaaaggaaagtg
gatgtcaccagcagggctgtgatggaaataatgactaaaacaattgaataccttcaaccc
aatccagcttccagagctaagctcagcatgatcaacaccatgtcaaaaatccgtggccag
gagaaggggccaggctatcctcaggcagaggcgctgctggcagaggccatgctcaaattt
ggaagagagcttggagatgattgcaactttggcccagcacttggtgaggtcggggaggcc
atgcgggaactgtcggaggtcaaagactctttggacatagaagtgaagcagaacttcatt
gaccctcttcagaatcttcatgacaaagatcttagggaaattcaacatcatctaaagaag
ttggagggtcgacgcctggattttgattataagaagaaacgacaaggcaagattccggat
gaagagcttcgtcaagctctagagaaatttgatgagtctaaggaaattgctgagtcaagc
atgttcaatctcttggagatggatattgaacaagtgagccagctctctgcacttgtgcaa
gctcagctggagtaccacaagcaggcagtccagatcctgcagcaagtcacggtcagactg
gaagaaagaataagacaggcttcatctcagcctagaagggaatatcaacctaaaccacga
atgagcctggagtttccaactggagacagtactcagcccaatgggggtctctcccacaca
ggcactcccaaaccttcaggtgtccaaatggatcagccctgctgccgagctctgtacgac
tttgaacctgaaaatgaaggggagttgggatttaaagagggcgatatcatcacactcact
aaccaaattgatgagaactggtatgaggggatgctgcatggccattcaggcttcttcccc
atcaattatgtggaaattctggttgccctgccccattag

KEGG   Homo sapiens (human): 6457Help
Entry
6457              CDS       T01001                                 

Gene name
SH3GL3, CNSA3, EEN-B2, HsT19371, SH3D2C, SH3P13
Definition
(RefSeq) SH3 domain containing GRB2 like 3, endophilin A3
  KO
K11247  endophilin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6457 (SH3GL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6457 (SH3GL3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    6457 (SH3GL3)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    6457 (SH3GL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_2 SH3_1 SH3_9 BAR_2 BAR_3 DUF824
Motif
Other DBs
NCBI-GeneID: 6457
NCBI-ProteinID: NP_003018
OMIM: 603362
HGNC: 10832
Ensembl: ENSG00000140600
Vega: OTTHUMG00000147361
Pharos: Q99963(Tbio)
UniProt: Q99963
LinkDB All DBs
Structure
PDB: 

Position
15q25.2
AA seq 347 aa AA seqDB search
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggccgggctgaagaagcagttccacaaagccagccagctatttagtgaaaaa
ataagtggtgctgaaggaactaaactagacgatgaatttcttgacatggaaaggaaaata
gatgttaccaataaagttgttgcagaaattctttcaaaaaccactgaatatcttcagcca
aatccagcatacagagctaagctaggaatgctgaacactgtgtcgaagatccgagggcag
gtgaagaccacaggatacccgcagacggaaggcttgctgggggactgtatgctgaaatac
gggaaggagctcggggaagactccacctttggcaatgcattgatagaagttggtgaatcc
atgaagctaatggctgaggtgaaagactctcttgatattaatgtaaagcaaacttttatt
gatccacttcagttactacaagataaagatttaaaagagatcgggcatcacctgaaaaag
ctggaaggccgccgcctggattacgattataaaaagaaacgagtaggtaagataccagac
gaagaagtcagacaagcggtagaaaaatttgaagagtcaaaggagttggctgaaagaagc
atgtttaactttttagaaaatgatgtagaacaagtcagccagttggctgtgttcatagag
gcagcattagactatcacagacagtccacagagattctgcaggagctgcagagcaagcta
cagatgcgaatatcagctgcatccagtgtccccagacgagaatacaagccaaggcctgtg
aaaaggagttctagtgagctcaatggagtttccaccacctctgtagtgaagacgacaggt
tctaacattcccatggaccagccctgctgtcgtggtctctatgactttgagccagaaaac
caaggagaattaggatttaaagaaggggacatcattacattaaccaatcaaatagatgaa
aactggtatgaaggaatgatacacggagaatcgggattcttccccattaattacgtggaa
gtgatcgtgcctttacctcagtaa

DBGET integrated database retrieval system