KEGG   Homo sapiens (human): 5111Help
Entry
5111              CDS       T01001                                 

Gene name
PCNA, ATLD2
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa04110  Cell cycle
hsa04530  Tight junction
hsa05161  Hepatitis B
Network
nt06162  Hepatitis B virus (HBV)
  Element
N00544  HBV HBx to CREB-mediated transcription
Disease
H02014  Ataxia-telangiectasia-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5111 (PCNA)
   03410 Base excision repair
    5111 (PCNA)
   03420 Nucleotide excision repair
    5111 (PCNA)
   03430 Mismatch repair
    5111 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5111 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5111 (PCNA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    5111 (PCNA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5111 (PCNA)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5111 (PCNA)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    5111 (PCNA)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     5111 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     5111 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    5111 (PCNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1
Motif
Other DBs
NCBI-GeneID: 5111
NCBI-ProteinID: NP_002583
OMIM: 176740
HGNC: 8729
Ensembl: ENSG00000132646
Vega: OTTHUMG00000031798
Pharos: P12004(Tchem)
UniProt: P12004
LinkDB All DBs
Structure
PDB: 

Position
20p12.3
AA seq 261 aa AA seqDB search
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggcgcgcctggtccagggctccatcctcaagaaggtgttggaggcactcaag
gacctcatcaacgaggcctgctgggatattagctccagcggtgtaaacctgcagagcatg
gactcgtcccacgtctctttggtgcagctcaccctgcggtctgagggcttcgacacctac
cgctgcgaccgcaacctggccatgggcgtgaacctcaccagtatgtccaaaatactaaaa
tgcgccggcaatgaagatatcattacactaagggccgaagataacgcggataccttggcg
ctagtatttgaagcaccaaaccaggagaaagtttcagactatgaaatgaagttgatggat
ttagatgttgaacaacttggaattccagaacaggagtacagctgtgtagtaaagatgcct
tctggtgaatttgcacgtatatgccgagatctcagccatattggagatgctgttgtaatt
tcctgtgcaaaagacggagtgaaattttctgcaagtggagaacttggaaatggaaacatt
aaattgtcacagacaagtaatgtcgataaagaggaggaagctgttaccatagagatgaat
gaaccagttcaactaacttttgcactgaggtacctgaacttctttacaaaagccactcca
ctctcttcaacggtgacactcagtatgtctgcagatgtaccccttgttgtagagtataaa
attgcggatatgggacacttaaaatactacttggctcccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system