KEGG   Homo sapiens (human): 51111Help
Entry
51111             CDS       T01001                                 

Gene name
KMT5B, CGI-85, CGI85, MRD51, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    51111 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51111 (KMT5B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     51111 (KMT5B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     51111 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 51111
NCBI-ProteinID: NP_060105
OMIM: 610881
HGNC: 24283
Ensembl: ENSG00000110066
Vega: OTTHUMG00000150484
Pharos: Q4FZB7(Tbio)
UniProt: Q4FZB7
LinkDB All DBs
Structure
PDB: 

Position
11q13.2
AA seq 885 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRR
SVRTRTNLKEASDIKLEPNTLNGYKSSVTEPCPDSGEQLQPAPVLQEEELAHETAQKGEA
KCHKSDTGMSKKKSRQGKLVKQFAKIEESTPVHDSPGKDDAVPDLMGPHSDQGEHSGTVG
VPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTL
RRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGSSSTKLKIQ
LKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccctg
aaggctggcaaaaatgcagtcgagaggaggtcgaacagatgtaatggtaactcgggattt
gaaggacagagtcgctatgtaccatcctctggaatgtccgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtgagatttaggcctattaaaggaaggcaggaagaactaaaggaagta
attgaacgttttaagaaagatgaacacttggagaaagccttcaaatgtttgacttcaggc
gaatgggcacggcactattttctcaacaagaataaaatgcaggagaaattattcaaagaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatattgccatgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtactccacaaggaaaaactgt
gctcaactctggctgggtcctgctgcgtttataaaccatgattgcagacctaattgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggctctaagagacattgaacctgga
gaagaaatttcttgttattatggagatgggttctttggagaaaataatgagttctgcgag
tgttacacttgcgaaagacggggcactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttggc
gtaaaaaagaatagcaagagcagaacgttaacgaggcaatctatgtcaagaattccagct
tcttccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaa
ctgaagaagcctgcaaagcctttactttcaaagataaaattgagaaatcattgcaagcgg
ctggagcaaaagaatgcttcaagaaaactcgaaatgggaaacttagtactgaaagagcct
aaagtagttctgtataaaaatttgcccattaaaaaagataaggagccagagggaccagcc
caagccgcagttgccagcgggtgcttgactagacacgcggcgagagaacacagacagaat
cctgtgagaggtgctcattcgcagggggagagctcgccctgcacctacataactcggcgg
tcagtgaggacaagaacaaatctgaaggaggcctctgacatcaagcttgaaccaaatacg
ttgaatggctataaaagcagtgtgacggaaccttgccccgacagtggtgaacagctgcag
ccagctcctgtgctgcaggaggaagaactggctcatgagactgcacaaaaaggggaggca
aagtgtcataagagtgacacaggcatgtccaaaaagaagtcacgacaaggaaaacttgtg
aaacagtttgcaaaaatagaggaatctactccagtgcacgattctcctggaaaagacgac
gcggtaccagatttgatgggtccccattctgaccagggtgagcacagtggcactgtgggc
gtgcctgtgagctacacagactgtgctccttcacccgtcggttgttcagttgtgacatca
gatagcttcaaaacaaaagacagctttagaactgcaaaaagtaaaaagaagaggcgaatc
acaaggtatgatgcacagttaatcctagaaaataactctgggattcccaaattgactctt
cgtaggcgtcatgatagcagcagcaaaacaaatgaccaagagaatgatggaatgaactct
tccaaaataagcatcaagttaagcaaagaccatgacaacgataacaatctctatgtagca
aagcttaataatggatttaactcaggatcaggcagtagttctacaaaattaaaaatccag
ctaaaacgagatgaggaaaatagggggtcttatacagaggggcttcatgaaaatggggtg
tgctgcagtgatcctctttctctcttggagtctcgaatggaggtggatgactatagtcag
tatgaggaagaaagtacagatgattcctcctcttctgagggcgatgaagaggaggatgac
tatgatgatgactttgaagacgattttattcctcttcctccagctaagcgcttgaggtta
atagttggaaaagactctatagatattgacatttcttcaaggagaagagaagatcagtct
ttaaggcttaatgcctaa

DBGET integrated database retrieval system