KEGG   Homo sapiens (human): 51128
Entry
51128             CDS       T01001                                 

Gene name
SAR1B, ANDD, CMRD, GTBPB, SARA2
Definition
(RefSeq) secretion associated Ras related GTPase 1B
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05134  Legionellosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Disease
H00927  Chylomicron retention disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51128 (SAR1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    51128 (SAR1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51128 (SAR1B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    51128 (SAR1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     51128 (SAR1B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    51128 (SAR1B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    51128 (SAR1B)
SSDB
Motif
Pfam: Arf G-alpha SRPRB Roc MMR_HSR1 Ras GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 51128
NCBI-ProteinID: NP_001028675
OMIM: 607690
HGNC: 10535
Ensembl: ENSG00000152700
Vega: OTTHUMG00000129114
Pharos: Q9Y6B6(Tbio)
UniProt: Q9Y6B6
LinkDB
Position
5q31.1
AA seq 198 aa
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtccttcatatttgattggatttacagtggtttcagcagtgtgctacagtttttagga
ttatataagaaaactggtaaactggtatttcttggattggataatgcaggaaaaacaaca
ttgctacacatgctaaaagatgacagacttggacaacatgtcccaacattacatcccact
tccgaagaactgaccattgctggcatgacgtttacaacttttgatctgggtggacatgtt
caagctcgaagagtgtggaaaaactaccttcctgctatcaatggcattgtatttctggtg
gattgtgcagaccacgaaaggctgttagagtcaaaagaagaacttgattcactaatgaca
gatgaaaccattgctaatgtgcctatactgattcttgggaataagatcgacagacctgaa
gccatcagtgaagagaggttgcgagagatgtttggtttatatggtcagacaacaggaaag
gggagtatatctctgaaagaactgaatgcccgacccttagaagttttcatgtgtagtgtg
ctcaaaagacaaggttacggagaaggcttccgctggatggcacagtacattgattaa

KEGG   Homo sapiens (human): 56681
Entry
56681             CDS       T01001                                 

Gene name
SAR1A, SAR1, SARA1, Sara, masra2
Definition
(RefSeq) secretion associated Ras related GTPase 1A
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05134  Legionellosis
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56681 (SAR1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    56681 (SAR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    56681 (SAR1A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    56681 (SAR1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     56681 (SAR1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    56681 (SAR1A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    56681 (SAR1A)
SSDB
Motif
Pfam: Arf SRPRB G-alpha Roc Ras MMR_HSR1 GTP_EFTU Metalloenzyme
Other DBs
NCBI-GeneID: 56681
NCBI-ProteinID: NP_001136120
OMIM: 607691
HGNC: 10534
Ensembl: ENSG00000079332
Vega: OTTHUMG00000018400
Pharos: Q9NR31(Tbio)
UniProt: Q9NR31 Q5SQT9
LinkDB
Structure
PDB: 
2GAO

Position
10q22.1
AA seq 198 aa
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMT
DETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSV
LKRQGYGEGFRWLSQYID
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtctttcatctttgagtggatctacaatggcttcagcagtgtgctccagttcctagga
ctgtacaagaaatctggaaaacttgtattcttaggtttggataatgcaggcaaaaccact
cttcttcacatgctcaaagatgacagattgggccaacatgttccaacactacatccgaca
tcagaagagctaacaattgctggaatgacctttacaacttttgatcttggtgggcacgag
caagcacgtcgcgtttggaaaaattatctcccagcaattaatgggattgtctttctggtg
gactgtgcagatcattctcgcctcgtggaatccaaagttgagcttaatgctttaatgact
gatgaaacaatatccaatgtgccaatccttatcttgggtaacaaaattgacagaacagat
gcaatcagtgaagaaaaactccgtgagatatttgggctttatggacagaccacaggaaag
gggaatgtgaccctgaaggagctgaatgctcgccccatggaagtgttcatgtgcagtgtg
ctcaagaggcaaggttacggcgagggtttccgctggctctcccagtatattgactga

DBGET integrated database retrieval system