KEGG   Homo sapiens (human): 51167Help
Entry
51167             CDS       T01001                                 

Gene name
CYB5R4, NCB5OR, cb5/cb5R, dJ676J13.1
Definition
(RefSeq) cytochrome b5 reductase 4
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51167 (CYB5R4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51167 (CYB5R4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyt-b5 FAD_binding_6 NAD_binding_1 CS NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 51167
NCBI-ProteinID: NP_057314
OMIM: 608343
HGNC: 20147
Ensembl: ENSG00000065615
Vega: OTTHUMG00000015118
Pharos: Q7L1T6(Tbio)
UniProt: Q7L1T6
LinkDB All DBs
Structure
PDB: 

Position
6q14.2
AA seq 521 aa AA seqDB search
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVT
IAIYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLF
TPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSKNEIHSFTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgtcccttcccagtctttcccggcccccaggtcgcagcagcgtgtcgcctcc
ggggggcgtagcaaggtacctttaaaacagggcagaagccttatggattggattcgactg
accaaaagtggaaaggatctaacgggattaaaaggcaggttaattgaagtaactgaagaa
gaacttaagaaacacaacaaaaaagatgattgttggatatgcataagaggtttcgtttat
aatgtcagcccttatatggagtatcatcctggtggagaagatgaactaatgagagcagca
ggatcagatggtactgaactttttgatcaggttcatcgttgggtcaattatgaatccatg
ctgaaagaatgcctggttggcagaatggccattaaacctgctgttctgaaagactatcgt
gaggaggaaaagaaagtcttaaatggcatgcttcccaagagccaagtgacagatacactt
gccaaagaaggtcctagttatccaagctatgattggttccaaacagactctttagtcacc
attgccatatatactaaacagaaggatatcaatttagactcaataatagttgatcatcag
aatgattcctttagagcagaaacaattattaaggattgtttatatcttatacatattggg
ctaagccatgaggttcaggaagatttttctgtgcgggttgttgagagtgtgggaaaaata
gagattgttctacaaaaaaaagagaatacttcttgggactttcttggccatcccctgaag
aatcataattcacttattccaaggaaagatacaggtttgtactacagaaagtgccagtta
atttccaaggaagatgttactcatgatacgaggcttttctgtttgatgctgccaccaagc
actcatcttcaagtgcccattgggcaacatgtttacctcaagctacctattacaggtaca
gaaatagtaaagccatatacacctgtatctggttccttactctcagagttcaaggaacca
gttcttcccaacaataaatacatctactttttgataaaaatctatcccactggactcttc
acaccagagcttgatcgtcttcagattggagattttgtttctgtaagcagtcctgagggc
aattttaaaatatccaagttccaagaattagaagatctctttttgttggcagctggaaca
ggcttcacaccaatggttaaaatactgaattatgctttgactgatatacccagtctcagg
aaagtgaagctgatgttcttcaataaaacagaagatgatataatttggagaagccaattg
gagaaattagcatttaaagataaaagactggatgttgaatttgttctctcagcacctatt
tctgaatggaatggcaaacagggacatatttcaccagctcttctttctgaatttttgaaa
agaaatttggacaaatccaaagttctcgtctgcatttgtggaccagtgccatttacagaa
caaggagtaaggttgctgcatgatctcaacttttccaaaaatgagatccatagttttaca
gcataa

DBGET integrated database retrieval system