KEGG   Homo sapiens (human): 51179
Entry
51179             CDS       T01001                                 

Gene name
HAO2, GIG16, HAOX2
Definition
(RefSeq) hydroxyacid oxidase 2
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    51179 (HAO2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51179 (HAO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     51179 (HAO2)
SSDB
Motif
Pfam: FMN_dh IMPDH Glu_synthase His_biosynth DHO_dh Ribul_P_3_epim
Other DBs
NCBI-GeneID: 51179
NCBI-ProteinID: NP_057611
OMIM: 605176
HGNC: 4810
Ensembl: ENSG00000116882
Vega: OTTHUMG00000012410
Pharos: Q9NYQ3(Tchem)
UniProt: Q9NYQ3
LinkDB
Position
1p12
AA seq 351 aa
MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDT
RTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAA
PEGLRWFQLYVHPDLQLNKQLIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLT
DLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG
IIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGVRTGNDVLKALALGAKCIFLG
RPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSRL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtccttggtgtgtttgacagactttcaggcccatgcgcgagagcagctgtctaagtca
actcgggattttattgaaggtggagcagatgacagcatcacgcgggatgacaacattgca
gcatttaaaagaattcgcctccgtccgcggtacctgagagatgtgtctgaggtggacacc
agaaccacaatccaaggggaggagatcagtgcccctatttgtatcgcacccacagggttc
cactgccttgtctggcctgatggggaaatgagcacagcaagagctgcccaagcggctggt
atctgctacatcaccagcacatttgccagctgtagccttgaagacattgtcattgcagct
cccgaaggcctccgatggttccaactctatgtgcatccagacctgcagctgaacaaacag
ttgatccagagggtagaatccctaggtttcaaagctttggtaataactttggatacacct
gtatgtggcaacaggcgacatgacattcgaaaccagttgaggaggaacttaacactaaca
gatcttcaatcacctaaaaagggaaatgcaataccttatttccagatgactcctatcagc
acttctctctgctggaatgatctctcctggtttcagagcataactcgattgcccatcatc
ctgaaagggattttgacaaaagaggatgcagagttagctgtgaagcacaatgtccagggt
atcattgtttccaaccatggtgggaggcagcttgatgaggttcttgcttcaattgatgct
ttgacagaagtggtggctgctgtaaaggggaaaattgaagtctacctggatggcggggtc
cgaactggcaatgatgtgctgaaggctctggcccttggagctaagtgcatttttcttggg
agaccaatcctatggggccttgcctgcaagggtgaacatggtgttaaggaagttttgaac
attttaacaaatgagttccacacttccatggcccttacaggctgccggtcggtcgctgag
atcaatcgaaacttggtccagttttccaggctgtaa

KEGG   Homo sapiens (human): 54363
Entry
54363             CDS       T01001                                 

Gene name
HAO1, GOX, GOX1, HAOX1
Definition
(RefSeq) hydroxyacid oxidase 1
  KO
K11517  (S)-2-hydroxy-acid oxidase [EC:1.1.3.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    54363 (HAO1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    54363 (HAO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     54363 (HAO1)
SSDB
Motif
Pfam: FMN_dh IMPDH Glu_synthase His_biosynth ThiG NMO TMP-TENI DHO_dh Peptidase_C32
Other DBs
NCBI-GeneID: 54363
NCBI-ProteinID: NP_060015
OMIM: 605023
HGNC: 4809
Ensembl: ENSG00000101323
Vega: OTTHUMG00000031841
Pharos: Q9UJM8(Tchem)
UniProt: Q9UJM8 A8K058
LinkDB
Structure
PDB: 

Position
20p12.3
AA seq 370 aa
MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAET
DLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAE
AGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQ
LRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILR
GDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
LKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RKNPLAVSKI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgctcccccggctaatttgtatcaatgattatgaacaacatgctaaatcagtacttcca
aagtctatatatgactattacaggtctggggcaaatgatgaagaaactttggctgataat
attgcagcattttccagatggaagctgtatccaaggatgctccggaatgttgctgaaaca
gatctgtcgacttctgttttaggacagagggtcagcatgccaatatgtgtgggggctacg
gccatgcagcgcatggctcatgtggacggcgagcttgccactgtgagagcctgtcagtcc
ctgggaacgggcatgatgttgagttcctgggccacctcctcaattgaagaagtggcggaa
gctggtcctgaggcacttcgttggctgcaactgtatatctacaaggaccgagaagtcacc
aagaagctagtgcggcaggcagagaagatgggctacaaggccatatttgtgacagtggac
acaccttacctgggcaaccgtctggatgatgtgcgtaacagattcaaactgccgccacaa
ctcaggatgaaaaattttgaaaccagtactttatcattttctcctgaggaaaattttgga
gacgacagtggacttgctgcatatgtggctaaagcaatagacccatctatcagctgggaa
gatatcaaatggctgagaagactgacatcattgccaattgttgcaaagggcattttgaga
ggtgatgatgccagggaggctgttaaacatggcttgaatgggatcttggtgtcgaatcat
ggggctcgacaactcgatggggtgccagccactattgatgttctgccagaaattgtggag
gctgtggaagggaaggtggaagtcttcctggacgggggtgtgcggaaaggcactgatgtt
ctgaaagctctggctcttggcgccaaggctgtgtttgtggggagaccaatcgtttggggc
ttagctttccagggggagaaaggtgttcaagatgtcctcgagatactaaaggaagaattc
cggttggccatggctctgagtgggtgccagaatgtgaaagtcatcgacaagacattggtg
aggaaaaatcctttggccgtttccaagatctga

DBGET integrated database retrieval system