KEGG   Homo sapiens (human): 51209Help
Entry
51209             CDS       T01001                                 

Gene name
RAB9B, RAB9L, Rab-9L
Definition
(RefSeq) RAB9B, member RAS oncogene family
  KO
K07900  Ras-related protein Rab-9B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    51209 (RAB9B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51209 (RAB9B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    51209 (RAB9B)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    51209 (RAB9B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    51209 (RAB9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_7 AAA_16
Motif
Other DBs
NCBI-GeneID: 51209
NCBI-ProteinID: NP_057454
OMIM: 300285
HGNC: 14090
Ensembl: ENSG00000123570
Vega: OTTHUMG00000022112
Pharos: Q9NP90(Tbio)
UniProt: Q9NP90
LinkDB All DBs
Structure
PDB: 

Position
Xq22.2
AA seq 201 aa AA seqDB search
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQI
WDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFV
VLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE
HCMLGHTIDLNSGSKAGSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaaatccctgctcttaaaggtcattctcttgggtgatggtggagttgggaaa
agttcgcttatgaaccgttacgtaaccaacaaatttgactcccaggcttttcacaccata
ggggtagagttcttaaatcgagatctggaggtagatggacgctttgtaaccctccagatc
tgggacactgcagggcaggaacgtttcaagagccttaggacacccttctacaggggagca
gactgctgcctcttgaccttcagcgtggatgatcggcagagcttcgagaatcttggtaac
tggcagaaagaatttatttactatgcggatgtgaaggaccctgagcatttcccctttgta
gttctgggtaacaaggtagacaaagaggataggcaagtgactactgaggaggcacaaacc
tggtgcatggagaatggggattacccttatttagaaactagtgccaaagatgatactaat
gtgacagtggcctttgaagaagctgtcaggcaggtgctggctgtagaggaacagctggag
cattgcatgttgggtcacaccattgacttgaacagtggctccaaagcagggtcttcgtgc
tgttaa

KEGG   Homo sapiens (human): 9367Help
Entry
9367              CDS       T01001                                 

Gene name
RAB9A, RAB9
Definition
(RefSeq) RAB9A, member RAS oncogene family
  KO
K07899  Ras-related protein Rab-9A
Organism
hsa  Homo sapiens (human)
Pathway
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    9367 (RAB9A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9367 (RAB9A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    9367 (RAB9A)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    9367 (RAB9A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    9367 (RAB9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU ATP_bind_1 G-alpha AAA_7 AAA_16 FeoB_N SRPRB
Motif
Other DBs
NCBI-GeneID: 9367
NCBI-ProteinID: NP_001182257
OMIM: 300284
HGNC: 9792
Ensembl: ENSG00000123595
Vega: OTTHUMG00000021156
Pharos: P51151(Tbio)
UniProt: P51151 A0A024RBV5
LinkDB All DBs
Structure
PDB: 

Position
Xp22.2
AA seq 201 aa AA seqDB search
MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD
HLIQTDTVNLHRKPKPSSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaatcatcactttttaaagtaattctccttggagatggtggagttgggaag
agttcacttatgaacagatatgtaactaataagtttgatacccagctcttccatacaata
ggtgtggaatttttaaataaagatttggaagtggatggacattttgttaccatgcagatt
tgggacacggcaggtcaggagcgattccgaagcctgaggacaccattttacagaggttct
gactgctgcctgcttacttttagtgtcgatgattcacaaagcttccagaacttaagtaac
tggaagaaagaattcatatattatgcagatgtgaaagagcctgagagctttccttttgtg
attctgggtaacaagattgacataagcgaacggcaggtgtctacagaagaagcccaagct
tggtgcagggacaacggcgactatccttattttgaaacaagtgcaaaagatgccacaaat
gtggcagcagcctttgaggaagcggttcgaagagttcttgctaccgaggataggtcagat
catttgattcagacagacacagtcaatcttcaccgaaagcccaagcctagctcatcttgc
tgttga

DBGET integrated database retrieval system