KEGG   Homo sapiens (human): 51227Help
Entry
51227             CDS       T01001                                 

Gene name
PIGP, DCRC, DCRC-S, DSCR5, DSRC, EIEE55, PIG-P
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class P
  KO
K03861  phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
N00752  PIGN deficiency in GPI-anchor biosynthesis
N00753  PIGV deficiency in GPI-anchor biosynthesis
N00754  PIGM deficiency in GPI-anchor biosynthesis
N00755  PIGW deficiency in GPI-anchor biosynthesis
N00756  PIGL deficiency in GPI-anchor biosynthesis
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    51227 (PIGP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-P DPM2 Phage_holin_3_6 SieB
Motif
Other DBs
NCBI-GeneID: 51227
NCBI-ProteinID: NP_710148
OMIM: 605938
HGNC: 3046
Ensembl: ENSG00000185808
Vega: OTTHUMG00000086653
Pharos: P57054(Tbio)
UniProt: P57054
LinkDB All DBs
Position
21q22.13
AA seq 158 aa AA seqDB search
MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFI
PESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAK
NQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtgccacggagcacatcgctgacgctgattgtgttccttttccacagattgtctaaa
gccccaggaaaaatggtggaaaattcaccgtcgccattgccagaaagagcgatttatggc
tttgttcttttcttaagctcccaatttggcttcatactttacctcgtgtgggcctttatt
cctgaatcttggctaaactctttaggtttaacctattggcctcaaaaatattgggcagtt
gcattacctgtctacctccttattgctatagtaattggctacgtgctcttgtttgggatt
aacatgatgagtacctctccactcgactccatccatacaatcacagataactatgcaaaa
aatcaacagcagaagaaataccaagaggaggccattccagccttaagagatatttctatt
agtgaagtaaaccaaatgttctttcttgcagccaaagaactttacaccaaaaactga

DBGET integrated database retrieval system