KEGG   Homo sapiens (human): 51284Help
Entry
51284             CDS       T01001                                 

Gene name
TLR7, TLR7-like
Definition
(RefSeq) toll like receptor 7
  KO
K05404  toll-like receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05162  Measles
hsa05164  Influenza A
Network
nt06121  TLR signaling (virus)
nt06169  Measles virus (MV)
  Element
N00690  TLR7/9-IRF7 signaling pathway
Drug target
Imiquimod: D02500
Isatoribine: D04619
Loxoribine: D04787
Vesatolimod: D11003
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    51284 (TLR7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    51284 (TLR7)
   05164 Influenza A
    51284 (TLR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    51284 (TLR7)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   51284 (TLR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 TIR LRR_9 LRR_12 TIR_2 LRR_6
Motif
Other DBs
NCBI-GeneID: 51284
NCBI-ProteinID: NP_057646
OMIM: 300365
HGNC: 15631
Ensembl: ENSG00000196664
Vega: OTTHUMG00000021137
Pharos: Q9NYK1(Tclin)
UniProt: Q9NYK1 B2R9N9
LinkDB All DBs
Position
Xp22.2
AA seq 1049 aa AA seqDB search
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttccaatgtggacactgaagagacaaattcttatcctttttaacataatccta
atttccaaactccttggggctagatggtttcctaaaactctgccctgtgatgtcactctg
gatgttccaaagaaccatgtgatcgtggactgcacagacaagcatttgacagaaattcct
ggaggtattcccacgaacaccacgaacctcaccctcaccattaaccacataccagacatc
tccccagcgtcctttcacagactggaccatctggtagagatcgatttcagatgcaactgt
gtacctattccactggggtcaaaaaacaacatgtgcatcaagaggctgcagattaaaccc
agaagctttagtggactcacttatttaaaatccctttacctggatggaaaccagctacta
gagataccgcagggcctcccgcctagcttacagcttctcagccttgaggccaacaacatc
ttttccatcagaaaagagaatctaacagaactggccaacatagaaatactctacctgggc
caaaactgttattatcgaaatccttgttatgtttcatattcaatagagaaagatgccttc
ctaaacttgacaaagttaaaagtgctctccctgaaagataacaatgtcacagccgtccct
actgttttgccatctactttaacagaactatatctctacaacaacatgattgcaaaaatc
caagaagatgattttaataacctcaaccaattacaaattcttgacctaagtggaaattgc
cctcgttgttataatgccccatttccttgtgcgccgtgtaaaaataattctcccctacag
atccctgtaaatgcttttgatgcgctgacagaattaaaagttttacgtctacacagtaac
tctcttcagcatgtgcccccaagatggtttaagaacatcaacaaactccaggaactggat
ctgtcccaaaacttcttggccaaagaaattggggatgctaaatttctgcattttctcccc
agcctcatccaattggatctgtctttcaattttgaacttcaggtctatcgtgcatctatg
aatctatcacaagcattttcttcactgaaaagcctgaaaattctgcggatcagaggatat
gtctttaaagagttgaaaagctttaacctctcgccattacataatcttcaaaatcttgaa
gttcttgatcttggcactaactttataaaaattgctaacctcagcatgtttaaacaattt
aaaagactgaaagtcatagatctttcagtgaataaaatatcaccttcaggagattcaagt
gaagttggcttctgctcaaatgccagaacttctgtagaaagttatgaaccccaggtcctg
gaacaattacattatttcagatatgataagtatgcaaggagttgcagattcaaaaacaaa
gaggcttctttcatgtctgttaatgaaagctgctacaagtatgggcagaccttggatcta
agtaaaaatagtatattttttgtcaagtcctctgattttcagcatctttctttcctcaaa
tgcctgaatctgtcaggaaatctcattagccaaactcttaatggcagtgaattccaacct
ttagcagagctgagatatttggacttctccaacaaccggcttgatttactccattcaaca
gcatttgaagagcttcacaaactggaagttctggatataagcagtaatagccattatttt
caatcagaaggaattactcatatgctaaactttaccaagaacctaaaggttctgcagaaa
ctgatgatgaacgacaatgacatctcttcctccaccagcaggaccatggagagtgagtct
cttagaactctggaattcagaggaaatcacttagatgttttatggagagaaggtgataac
agatacttacaattattcaagaatctgctaaaattagaggaattagacatctctaaaaat
tccctaagtttcttgccttctggagtttttgatggtatgcctccaaatctaaagaatctc
tctttggccaaaaatgggctcaaatctttcagttggaagaaactccagtgtctaaagaac
ctggaaactttggacctcagccacaaccaactgaccactgtccctgagagattatccaac
tgttccagaagcctcaagaatctgattcttaagaataatcaaatcaggagtctgacgaag
tattttctacaagatgccttccagttgcgatatctggatctcagctcaaataaaatccag
atgatccaaaagaccagcttcccagaaaatgtcctcaacaatctgaagatgttgcttttg
catcataatcggtttctgtgcacctgtgatgctgtgtggtttgtctggtgggttaaccat
acggaggtgactattccttacctggccacagatgtgacttgtgtggggccaggagcacac
aagggccaaagtgtgatctccctggatctgtacacctgtgagttagatctgactaacctg
attctgttctcactttccatatctgtatctctctttctcatggtgatgatgacagcaagt
cacctctatttctgggatgtgtggtatatttaccatttctgtaaggccaagataaagggg
tatcagcgtctaatatcaccagactgttgctatgatgcttttattgtgtatgacactaaa
gacccagctgtgaccgagtgggttttggctgagctggtggccaaactggaagacccaaga
gagaaacattttaatttatgtctcgaggaaagggactggttaccagggcagccagttctg
gaaaacctttcccagagcatacagcttagcaaaaagacagtgtttgtgatgacagacaag
tatgcaaagactgaaaattttaagatagcattttacttgtcccatcagaggctcatggat
gaaaaagttgatgtgattatcttgatatttcttgagaagccctttcagaagtccaagttc
ctccagctccggaaaaggctctgtgggagttctgtccttgagtggccaacaaacccgcaa
gctcacccatacttctggcagtgtctaaagaacgccctggccacagacaatcatgtggcc
tatagtcaggtgttcaaggaaacggtctag

KEGG   Homo sapiens (human): 51311Help
Entry
51311             CDS       T01001                                 

Gene name
TLR8, CD288
Definition
(RefSeq) toll like receptor 8
  KO
K10170  toll-like receptor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
Drug target
Motolimod: D10716
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    51311 (TLR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    51311 (TLR8)
   04090 CD molecules [BR:hsa04090]
    51311 (TLR8)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   51311 (TLR8)
CD molecules [BR:hsa04090]
 Proteins
  51311 (TLR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 TIR LRR_1 LRR_5 TIR_2 LRR_9 LRR_12
Motif
Other DBs
NCBI-GeneID: 51311
NCBI-ProteinID: NP_619542
OMIM: 300366
HGNC: 15632
Ensembl: ENSG00000101916
Vega: OTTHUMG00000021145
Pharos: Q9NR97(Tbio)
UniProt: Q9NR97
LinkDB All DBs
Structure
PDB: 

Position
Xp22.2
AA seq 1041 aa AA seqDB search
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIKQY
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatgttccttcagtcgtcaatgctgacctgcattttcctgctaatatctggt
tcctgtgagttatgcgccgaagaaaatttttctagaagctatccttgtgatgagaaaaag
caaaatgactcagttattgcagagtgcagcaatcgtcgactacaggaagttccccaaacg
gtgggcaaatatgtgacagaactagacctgtctgataatttcatcacacacataacgaat
gaatcatttcaagggctgcaaaatctcactaaaataaatctaaaccacaaccccaatgta
cagcaccagaacggaaatcccggtatacaatcaaatggcttgaatatcacagacggggca
ttcctcaacctaaaaaacctaagggagttactgcttgaagacaaccagttaccccaaata
ccctctggtttgccagagtctttgacagaacttagtctaattcaaaacaatatatacaac
ataactaaagagggcatttcaagacttataaacttgaaaaatctctatttggcctggaac
tgctattttaacaaagtttgcgagaaaactaacatagaagatggagtatttgaaacgctg
acaaatttggagttgctatcactatctttcaattctctttcacacgtgccacccaaactg
ccaagctccctacgcaaactttttctgagcaacacccagatcaaatacattagtgaagaa
gatttcaagggattgataaatttaacattactagatttaagcgggaactgtccgaggtgc
ttcaatgccccatttccatgcgtgccttgtgatggtggtgcttcaattaatatagatcgt
tttgcttttcaaaacttgacccaacttcgatacctaaacctctctagcacttccctcagg
aagattaatgctgcctggtttaaaaatatgcctcatctgaaggtgctggatcttgaattc
aactatttagtgggagaaatagcctctggggcatttttaacgatgctgccccgcttagaa
atacttgacttgtcttttaactatataaaggggagttatccacagcatattaatatttcc
agaaacttctctaaacttttgtctctacgggcattgcatttaagaggttatgtgttccag
gaactcagagaagatgatttccagcccctgatgcagcttccaaacttatcgactatcaac
ttgggtattaattttattaagcaaatcgatttcaaacttttccaaaatttctccaatctg
gaaattatttacttgtcagaaaacagaatatcaccgttggtaaaagatacccggcagagt
tatgcaaatagttcctcttttcaacgtcatatccggaaacgacgctcaacagattttgag
tttgacccacattcgaacttttatcatttcacccgtcctttaataaagccacaatgtgct
gcttatggaaaagccttagatttaagcctcaacagtattttcttcattgggccaaaccaa
tttgaaaatcttcctgacattgcctgtttaaatctgtctgcaaatagcaatgctcaagtg
ttaagtggaactgaattttcagccattcctcatgtcaaatatttggatttgacaaacaat
agactagactttgataatgctagtgctcttactgaattgtccgacttggaagttctagat
ctcagctataattcacactatttcagaatagcaggcgtaacacatcatctagaatttatt
caaaatttcacaaatctaaaagttttaaacttgagccacaacaacatttatactttaaca
gataagtataacctggaaagcaagtccctggtagaattagttttcagtggcaatcgcctt
gacattttgtggaatgatgatgacaacaggtatatctccattttcaaaggtctcaagaat
ctgacacgtctggatttatcccttaataggctgaagcacatcccaaatgaagcattcctt
aatttgccagcgagtctcactgaactacatataaatgataatatgttaaagttttttaac
tggacattactccagcagtttcctcgtctcgagttgcttgacttacgtggaaacaaacta
ctctttttaactgatagcctatctgactttacatcttcccttcggacactgctgctgagt
cataacaggatttcccacctaccctctggctttctttctgaagtcagtagtctgaagcac
ctcgatttaagttccaatctgctaaaaacaatcaacaaatccgcacttgaaactaagacc
accaccaaattatctatgttggaactacacggaaacccctttgaatgcacctgtgacatt
ggagatttccgaagatggatggatgaacatctgaatgtcaaaattcccagactggtagat
gtcatttgtgccagtcctggggatcaaagagggaagagtattgtgagtctggagctaaca
acttgtgtttcagatgtcactgcagtgatattatttttcttcacgttctttatcaccacc
atggttatgttggctgccctggctcaccatttgttttactgggatgtttggtttatatat
aatgtgtgtttagctaaggtaaaaggctacaggtctctttccacatcccaaactttctat
gatgcttacatttcttatgacaccaaagatgcctctgttactgactgggtgataaatgag
ctgcgctaccaccttgaagagagccgagacaaaaacgttctcctttgtctagaggagagg
gattgggacccgggattggccatcatcgacaacctcatgcagagcatcaaccaaagcaag
aaaacagtatttgttttaaccaaaaaatatgcaaaaagctggaactttaaaacagctttt
tacttggctttgcagaggctaatggatgagaacatggatgtgattatatttatcctgctg
gagccagtgttacagcattctcagtatttgaggctacggcagcggatctgtaagagctcc
atcctccagtggcctgacaacccgaaggcagaaggcttgttttggcaaactctgagaaat
gtggtcttgactgaaaatgattcacggtataacaatatgtatgtcgattccattaagcaa
tactaa

DBGET integrated database retrieval system