KEGG   Homo sapiens (human): 51284Help
Entry
51284             CDS       T01001                                 

Gene name
TLR7, TLR7-like
Definition
(RefSeq) toll like receptor 7
  KO
K05404  toll-like receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05162  Measles
hsa05164  Influenza A
Network
nt06121  TLR signaling (viruses and bacteria)
nt06169  Measles virus (MV)
  Element
N00690  TLR7/9-IRF7 signaling pathway
Drug target
Imiquimod: D02500
Isatoribine: D04619
Loxoribine: D04787
Vesatolimod: D11003
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    51284 (TLR7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    51284 (TLR7)
   05164 Influenza A
    51284 (TLR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    51284 (TLR7)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   51284 (TLR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 TIR LRR_9 LRR_12 TIR_2 LRR_6
Motif
Other DBs
NCBI-GeneID: 51284
NCBI-ProteinID: NP_057646
OMIM: 300365
HGNC: 15631
Ensembl: ENSG00000196664
Vega: OTTHUMG00000021137
Pharos: Q9NYK1(Tclin)
UniProt: Q9NYK1 B2R9N9
LinkDB All DBs
Position
Xp22.2
AA seq 1049 aa AA seqDB search
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttccaatgtggacactgaagagacaaattcttatcctttttaacataatccta
atttccaaactccttggggctagatggtttcctaaaactctgccctgtgatgtcactctg
gatgttccaaagaaccatgtgatcgtggactgcacagacaagcatttgacagaaattcct
ggaggtattcccacgaacaccacgaacctcaccctcaccattaaccacataccagacatc
tccccagcgtcctttcacagactggaccatctggtagagatcgatttcagatgcaactgt
gtacctattccactggggtcaaaaaacaacatgtgcatcaagaggctgcagattaaaccc
agaagctttagtggactcacttatttaaaatccctttacctggatggaaaccagctacta
gagataccgcagggcctcccgcctagcttacagcttctcagccttgaggccaacaacatc
ttttccatcagaaaagagaatctaacagaactggccaacatagaaatactctacctgggc
caaaactgttattatcgaaatccttgttatgtttcatattcaatagagaaagatgccttc
ctaaacttgacaaagttaaaagtgctctccctgaaagataacaatgtcacagccgtccct
actgttttgccatctactttaacagaactatatctctacaacaacatgattgcaaaaatc
caagaagatgattttaataacctcaaccaattacaaattcttgacctaagtggaaattgc
cctcgttgttataatgccccatttccttgtgcgccgtgtaaaaataattctcccctacag
atccctgtaaatgcttttgatgcgctgacagaattaaaagttttacgtctacacagtaac
tctcttcagcatgtgcccccaagatggtttaagaacatcaacaaactccaggaactggat
ctgtcccaaaacttcttggccaaagaaattggggatgctaaatttctgcattttctcccc
agcctcatccaattggatctgtctttcaattttgaacttcaggtctatcgtgcatctatg
aatctatcacaagcattttcttcactgaaaagcctgaaaattctgcggatcagaggatat
gtctttaaagagttgaaaagctttaacctctcgccattacataatcttcaaaatcttgaa
gttcttgatcttggcactaactttataaaaattgctaacctcagcatgtttaaacaattt
aaaagactgaaagtcatagatctttcagtgaataaaatatcaccttcaggagattcaagt
gaagttggcttctgctcaaatgccagaacttctgtagaaagttatgaaccccaggtcctg
gaacaattacattatttcagatatgataagtatgcaaggagttgcagattcaaaaacaaa
gaggcttctttcatgtctgttaatgaaagctgctacaagtatgggcagaccttggatcta
agtaaaaatagtatattttttgtcaagtcctctgattttcagcatctttctttcctcaaa
tgcctgaatctgtcaggaaatctcattagccaaactcttaatggcagtgaattccaacct
ttagcagagctgagatatttggacttctccaacaaccggcttgatttactccattcaaca
gcatttgaagagcttcacaaactggaagttctggatataagcagtaatagccattatttt
caatcagaaggaattactcatatgctaaactttaccaagaacctaaaggttctgcagaaa
ctgatgatgaacgacaatgacatctcttcctccaccagcaggaccatggagagtgagtct
cttagaactctggaattcagaggaaatcacttagatgttttatggagagaaggtgataac
agatacttacaattattcaagaatctgctaaaattagaggaattagacatctctaaaaat
tccctaagtttcttgccttctggagtttttgatggtatgcctccaaatctaaagaatctc
tctttggccaaaaatgggctcaaatctttcagttggaagaaactccagtgtctaaagaac
ctggaaactttggacctcagccacaaccaactgaccactgtccctgagagattatccaac
tgttccagaagcctcaagaatctgattcttaagaataatcaaatcaggagtctgacgaag
tattttctacaagatgccttccagttgcgatatctggatctcagctcaaataaaatccag
atgatccaaaagaccagcttcccagaaaatgtcctcaacaatctgaagatgttgcttttg
catcataatcggtttctgtgcacctgtgatgctgtgtggtttgtctggtgggttaaccat
acggaggtgactattccttacctggccacagatgtgacttgtgtggggccaggagcacac
aagggccaaagtgtgatctccctggatctgtacacctgtgagttagatctgactaacctg
attctgttctcactttccatatctgtatctctctttctcatggtgatgatgacagcaagt
cacctctatttctgggatgtgtggtatatttaccatttctgtaaggccaagataaagggg
tatcagcgtctaatatcaccagactgttgctatgatgcttttattgtgtatgacactaaa
gacccagctgtgaccgagtgggttttggctgagctggtggccaaactggaagacccaaga
gagaaacattttaatttatgtctcgaggaaagggactggttaccagggcagccagttctg
gaaaacctttcccagagcatacagcttagcaaaaagacagtgtttgtgatgacagacaag
tatgcaaagactgaaaattttaagatagcattttacttgtcccatcagaggctcatggat
gaaaaagttgatgtgattatcttgatatttcttgagaagccctttcagaagtccaagttc
ctccagctccggaaaaggctctgtgggagttctgtccttgagtggccaacaaacccgcaa
gctcacccatacttctggcagtgtctaaagaacgccctggccacagacaatcatgtggcc
tatagtcaggtgttcaaggaaacggtctag

KEGG   Homo sapiens (human): 54106Help
Entry
54106             CDS       T01001                                 

Gene name
TLR9, CD289
Definition
(RefSeq) toll like receptor 9
  KO
K10161  toll-like receptor 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05152  Tuberculosis
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06121  TLR signaling (viruses and bacteria)
nt06169  Measles virus (MV)
  Element
N00690  TLR7/9-IRF7 signaling pathway
Disease
H01358  Atopic dermatitis
Drug target
Agatolimod (DG01428): D08841 D08842
Tilsotolimod (DG03024): D11504 D11505
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    54106 (TLR9)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    54106 (TLR9)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    54106 (TLR9)
  09172 Infectious disease: viral
   05162 Measles
    54106 (TLR9)
   05168 Herpes simplex virus 1 infection
    54106 (TLR9)
  09174 Infectious disease: parasitic
   05144 Malaria
    54106 (TLR9)
   05142 Chagas disease (American trypanosomiasis)
    54106 (TLR9)
   05143 African trypanosomiasis
    54106 (TLR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    54106 (TLR9)
   04090 CD molecules [BR:hsa04090]
    54106 (TLR9)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   54106 (TLR9)
CD molecules [BR:hsa04090]
 Proteins
  54106 (TLR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_12 TIR LRR_9 LRR_5 TIR_2 FNIP
Motif
Other DBs
NCBI-GeneID: 54106
NCBI-ProteinID: NP_059138
OMIM: 605474
HGNC: 15633
Ensembl: ENSG00000239732
Vega: OTTHUMG00000158106
Pharos: Q9NR96(Tclin)
UniProt: Q9NR96
LinkDB All DBs
Position
3p21.2
AA seq 1032 aa AA seqDB search
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgccgcagcgccctgcacccgctgtctctcctggtgcaggccatcatgctg
gccatgaccctggccctgggtaccttgcctgccttcctaccctgtgagctccagccccac
ggcctggtgaactgcaactggctgttcctgaagtctgtgccccacttctccatggcagca
ccccgtggcaatgtcaccagcctttccttgtcctccaaccgcatccaccacctccatgat
tctgactttgcccacctgcccagcctgcggcatctcaacctcaagtggaactgcccgccg
gttggcctcagccccatgcacttcccctgccacatgaccatcgagcccagcaccttcttg
gctgtgcccaccctggaagagctaaacctgagctacaacaacatcatgactgtgcctgcg
ctgcccaaatccctcatatccctgtccctcagccataccaacatcctgatgctagactct
gccagcctcgccggcctgcatgccctgcgcttcctattcatggacggcaactgttattac
aagaacccctgcaggcaggcactggaggtggccccgggtgccctccttggcctgggcaac
ctcacccacctgtcactcaagtacaacaacctcactgtggtgccccgcaacctgccttcc
agcctggagtatctgctgttgtcctacaaccgcatcgtcaaactggcgcctgaggacctg
gccaatctgaccgccctgcgtgtgctcgatgtgggcggaaattgccgccgctgcgaccac
gctcccaacccctgcatggagtgccctcgtcacttcccccagctacatcccgataccttc
agccacctgagccgtcttgaaggcctggtgttgaaggacagttctctctcctggctgaat
gccagttggttccgtgggctgggaaacctccgagtgctggacctgagtgagaacttcctc
tacaaatgcatcactaaaaccaaggccttccagggcctaacacagctgcgcaagcttaac
ctgtccttcaattaccaaaagagggtgtcctttgcccacctgtctctggccccttccttc
gggagcctggtcgccctgaaggagctggacatgcacggcatcttcttccgctcactcgat
gagaccacgctccggccactggcccgcctgcccatgctccagactctgcgtctgcagatg
aacttcatcaaccaggcccagctcggcatcttcagggccttccctggcctgcgctacgtg
gacctgtcggacaaccgcatcagcggagcttcggagctgacagccaccatgggggaggca
gatggaggggagaaggtctggctgcagcctggggaccttgctccggccccagtggacact
cccagctctgaagacttcaggcccaactgcagcaccctcaacttcaccttggatctgtca
cggaacaacctggtgaccgtgcagccggagatgtttgcccagctctcgcacctgcagtgc
ctgcgcctgagccacaactgcatctcgcaggcagtcaatggctcccagttcctgccgctg
accggtctgcaggtgctagacctgtcccacaataagctggacctctaccacgagcactca
ttcacggagctaccgcgactggaggccctggacctcagctacaacagccagccctttggc
atgcagggcgtgggccacaacttcagcttcgtggctcacctgcgcaccctgcgccacctc
agcctggcccacaacaacatccacagccaagtgtcccagcagctctgcagtacgtcgctg
cgggccctggacttcagcggcaatgcactgggccatatgtgggccgagggagacctctat
ctgcacttcttccaaggcctgagcggtttgatctggctggacttgtcccagaaccgcctg
cacaccctcctgccccaaaccctgcgcaacctccccaagagcctacaggtgctgcgtctc
cgtgacaattacctggccttctttaagtggtggagcctccacttcctgcccaaactggaa
gtcctcgacctggcaggaaaccagctgaaggccctgaccaatggcagcctgcctgctggc
acccggctccggaggctggatgtcagctgcaacagcatcagcttcgtggcccccggcttc
ttttccaaggccaaggagctgcgagagctcaaccttagcgccaacgccctcaagacagtg
gaccactcctggtttgggcccctggcgagtgccctgcaaatactagatgtaagcgccaac
cctctgcactgcgcctgtggggcggcctttatggacttcctgctggaggtgcaggctgcc
gtgcccggtctgcccagccgggtgaagtgtggcagtccgggccagctccagggcctcagc
atctttgcacaggacctgcgcctctgcctggatgaggccctctcctgggactgtttcgcc
ctctcgctgctggctgtggctctgggcctgggtgtgcccatgctgcatcacctctgtggc
tgggacctctggtactgcttccacctgtgcctggcctggcttccctggcgggggcggcaa
agtgggcgagatgaggatgccctgccctacgatgccttcgtggtcttcgacaaaacgcag
agcgcagtggcagactgggtgtacaacgagcttcgggggcagctggaggagtgccgtggg
cgctgggcactccgcctgtgcctggaggaacgcgactggctgcctggcaaaaccctcttt
gagaacctgtgggcctcggtctatggcagccgcaagacgctgtttgtgctggcccacacg
gaccgggtcagtggtctcttgcgcgccagcttcctgctggcccagcagcgcctgctggag
gaccgcaaggacgtcgtggtgctggtgatcctgagccctgacggccgccgctcccgctac
gtgcggctgcgccagcgcctctgccgccagagtgtcctcctctggccccaccagcccagt
ggtcagcgcagcttctgggcccagctgggcatggccctgaccagggacaaccaccacttc
tataaccggaacttctgccagggacccacggccgaatag

DBGET integrated database retrieval system