KEGG   Homo sapiens (human): 51343Help
Entry
51343             CDS       T01001                                 

Gene name
FZR1, CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1
Definition
(RefSeq) fizzy and cell division cycle 20 related 1
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    51343 (FZR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    51343 (FZR1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    51343 (FZR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51343 (FZR1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     51343 (FZR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 51343
NCBI-ProteinID: NP_001129670
OMIM: 603619
HGNC: 24824
Ensembl: ENSG00000105325
Vega: OTTHUMG00000180747
Pharos: Q9UM11(Tbio)
UniProt: Q9UM11
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 496 aa AA seqDB search
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRT
PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
VKWESVSVLNLFTRIR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggactatgagcggcgcctgcttcgccagatcgtcatccagaatgagaacacg
atgccacgcgtcacagagatgcggcggaccctgacgcctgccagctccccagtgtcctcg
cccagcaagcacggagaccgcttcatcccctccagagccggagccaactggagcgtgaac
ttccacaggattaacgagaatgagaagtctcccagtcagaaccggaaagccaaggacgcc
acctcagacaacggcaaagacggcctggcctactctgccctgctcaagaatgagctgctg
ggtgccggcatcgagaaggtgcaggacccgcagactgaggaccgcaggctgcagccctcc
acgcctgagaagaagggtctgttcacgtattcccttagcaccaagcgctccagccccgat
gacggcaacgatgtgtctccctactccctgtctcccgtcagcaacaagagccagaagctg
ctccggtccccccggaaacccacccgcaagatctccaagatccccttcaaggtgctggac
gcgcccgagctgcaggacgacttctacctcaatctggtggactggtcgtccctcaatgtg
ctcagcgtggggctaggcacctgcgtgtacctgtggagtgcctgtaccagccaggtgacg
cggctctgtgacctctcagtggaaggggactcagtgacctccgtgggctggtctgagcgg
gggaacctggtggcggtgggcacacacaagggcttcgtgcagatctgggacgcagccgca
gggaagaagctgtccatgttggagggccacacggcacgcgtcggggcgctggcctggaat
gctgagcagctgtcgtccgggagccgcgaccgcatgatcctgcagagggacatccgcacc
ccgccactgcagtcggagcggcggctgcagggccaccggcaggaggtgtgcgggctcaag
tggtccacagaccaccagctcctcgcctcggggggcaacgacaacaagctgctggtctgg
aatcactcgagcctgagccccgtgcagcagtacacggagcacctggcggccgtgaaggcc
atcgcctggtccccacatcagcacgggctgctggcctcggggggcggcacagctgaccgc
tgtatccgcttctggaacacgctgacaggacaaccactgcagtgtatcgacacgggctcc
caagtgtgcaatctggcctggtccaagcacgccaacgagctggtgagcacgcacggctac
tcacagaaccagatccttgtctggaagtacccctccctgacccaggtggccaagctgacc
gggcactcctaccgcgtgctgtacctggcaatgtcccctgatggggaggccatcgtcact
ggtgctggagacgagaccctgaggttctggaacgtctttagcaaaacccgttcgacaaag
gtaaagtgggagtctgtgtctgtgctcaacctcttcaccaggatccggtaa

DBGET integrated database retrieval system