KEGG   Homo sapiens (human): 51384Help
Entry
51384             CDS       T01001                                 

Gene name
WNT16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00117  E2A-PBX1 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    51384 (WNT16)
   04390 Hippo signaling pathway
    51384 (WNT16)
   04150 mTOR signaling pathway
    51384 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    51384 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    51384 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51384 (WNT16)
   05202 Transcriptional misregulation in cancer
    51384 (WNT16)
   05205 Proteoglycans in cancer
    51384 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    51384 (WNT16)
   05226 Gastric cancer
    51384 (WNT16)
   05217 Basal cell carcinoma
    51384 (WNT16)
   05224 Breast cancer
    51384 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    51384 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    51384 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    51384 (WNT16)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   51384 (WNT16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 51384
NCBI-ProteinID: NP_476509
OMIM: 606267
HGNC: 16267
Ensembl: ENSG00000002745
Vega: OTTHUMG00000156963
Pharos: Q9UBV4(Tbio)
UniProt: Q9UBV4
LinkDB All DBs
Position
7q31.31
AA seq 365 aa AA seqDB search
MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggacagggcggcgctcctgggactggcccgcttgtgcgcgctgtgggcagccctgctc
gtgctgttcccctacggagcccaaggaaactggatgtggttgggcattgcctccttcggg
gttccagagaagctgggctgcgccaatttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgagagggcgcccggctgggcattcaggag
tgcgggagccagttcagacacgagagatggaactgcatgatcaccgccgccgccactacc
gccccgatgggcgccagccccctctttggctacgagctgagcagcggcaccaaagagaca
gcatttatttatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagt
gcaggcaacatgacagagtgttcctgtgacaccaccttgcagaacggcggctcagcaagt
gaaggctggcactgggggggctgctccgatgatgtccagtatggcatgtggttcagcaga
aagttcctagatttccccatcggaaacaccacgggcaaagaaaacaaagtactattagca
atgaacctacataacaatgaagctggaaggcaggctgtcgccaagttgatgtcagtagac
tgccgctgccacggagtttccggctcctgtgctgtgaaaacatgctggaaaaccatgtct
tcttttgaaaagattggccatttgttgaaggataaatatgaaaacagtatccagatatca
gacaaaacaaagaggaaaatgcgcaggagagaaaaagatcagaggaaaataccaatccat
aaggatgatctgctctatgttaataagtctcccaactactgtgtagaagataagaaactg
ggaatcccagggacacaaggcagagaatgcaaccgtacatcagagggtgcagatggctgc
aacctcctctgctgtggccgaggttacaacacccatgtggtcaggcacgtggagaggtgt
gagtgtaagttcatctggtgctgctatgtccgttgcaggaggtgtgaaagcatgactgat
gtccacacttgcaagtaa

KEGG   Homo sapiens (human): 54361Help
Entry
54361             CDS       T01001                                 

Gene name
WNT4, SERKAL, WNT-4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04919  Thyroid hormone signaling pathway
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00600  Mullerian agenesis
H02317  SERKAL syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    54361 (WNT4)
   04390 Hippo signaling pathway
    54361 (WNT4)
   04150 mTOR signaling pathway
    54361 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    54361 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    54361 (WNT4)
   04916 Melanogenesis
    54361 (WNT4)
  09158 Development
   04360 Axon guidance
    54361 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54361 (WNT4)
   05205 Proteoglycans in cancer
    54361 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    54361 (WNT4)
   05226 Gastric cancer
    54361 (WNT4)
   05217 Basal cell carcinoma
    54361 (WNT4)
   05224 Breast cancer
    54361 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54361 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    54361 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    54361 (WNT4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   54361 (WNT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt MEF2_binding
Motif
Other DBs
NCBI-GeneID: 54361
NCBI-ProteinID: NP_110388
OMIM: 603490
HGNC: 12783
Ensembl: ENSG00000162552
Vega: OTTHUMG00000002894
Pharos: P56705(Tbio)
UniProt: P56705
LinkDB All DBs
Position
1p36.12
AA seq 351 aa AA seqDB search
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagtccccgctcgtgcctgcgttcgctgcgcctcctcgtcttcgccgtcttctcagcc
gccgcgagcaactggctgtacctggccaagctgtcgtcggtggggagcatctcagaggag
gagacgtgcgagaaactcaagggcctgatccagaggcaggtgcagatgtgcaagcggaac
ctggaagtcatggactcggtgcgccgcggtgcccagctggccattgaggagtgccagtac
cagttccggaaccggcgctggaactgctccacactcgactccttgcccgtcttcggcaag
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcggcaggtgtg
gcctttgcagtgacgcgggcgtgcagcagtggggagctggagaagtgcggctgtgacagg
acagtgcatggggtcagcccacagggcttccagtggtcaggatgctctgacaacatcgcc
tacggtgtggccttctcacagtcgtttgtggatgtgcgggagagaagcaagggggcctcg
tccagcagagccctcatgaacctccacaacaatgaggccggcaggaaggccatcctgaca
cacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggtcacgcactgaaggagaagtttgatggt
gccactgaggtggagccacgccgcgtgggctcctccagggcactggtgccacgcaacgca
cagttcaagccgcacacagatgaggacctggtgtacttggagcctagccccgacttctgt
gagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacatgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcgcaggtg
gagctggctgaacgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagttgcacacgtgccgatga

KEGG   Homo sapiens (human): 7471Help
Entry
7471              CDS       T01001                                 

Gene name
WNT1, BMND16, INT1, OI15
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00506  Osteogenesis imperfecta
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7471 (WNT1)
   04390 Hippo signaling pathway
    7471 (WNT1)
   04150 mTOR signaling pathway
    7471 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7471 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7471 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7471 (WNT1)
   05205 Proteoglycans in cancer
    7471 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7471 (WNT1)
   05226 Gastric cancer
    7471 (WNT1)
   05217 Basal cell carcinoma
    7471 (WNT1)
   05224 Breast cancer
    7471 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7471 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7471 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7471 (WNT1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7471 (WNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7471
NCBI-ProteinID: NP_005421
OMIM: 164820
HGNC: 12774
Ensembl: ENSG00000125084
Vega: OTTHUMG00000170403
Pharos: P04628(Tbio)
UniProt: P04628
LinkDB All DBs
Position
12q13.12
AA seq 370 aa AA seqDB search
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Homo sapiens (human): 7472Help
Entry
7472              CDS       T01001                                 

Gene name
WNT2, INT1L1, IRP
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7472 (WNT2)
   04390 Hippo signaling pathway
    7472 (WNT2)
   04150 mTOR signaling pathway
    7472 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7472 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7472 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7472 (WNT2)
   05205 Proteoglycans in cancer
    7472 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7472 (WNT2)
   05226 Gastric cancer
    7472 (WNT2)
   05217 Basal cell carcinoma
    7472 (WNT2)
   05224 Breast cancer
    7472 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7472 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7472 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7472 (WNT2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7472 (WNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7472
NCBI-ProteinID: NP_003382
OMIM: 147870
HGNC: 12780
Ensembl: ENSG00000105989
Vega: OTTHUMG00000023428
Pharos: P09544(Tbio)
UniProt: P09544 A0A384MDX3
LinkDB All DBs
Position
7q31.2
AA seq 360 aa AA seqDB search
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcagaatgccagcaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctttttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcctgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaaaggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgtgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtgggtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaagctctggatgtgcacacatgcaaggcccccaagaacgctgactggacaaccgctaca
tga

KEGG   Homo sapiens (human): 7473Help
Entry
7473              CDS       T01001                                 

Gene name
WNT3, INT4, TETAMS
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00636  Tetra-amelia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7473 (WNT3)
   04390 Hippo signaling pathway
    7473 (WNT3)
   04150 mTOR signaling pathway
    7473 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7473 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7473 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7473 (WNT3)
   05206 MicroRNAs in cancer
    7473 (WNT3)
   05205 Proteoglycans in cancer
    7473 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7473 (WNT3)
   05226 Gastric cancer
    7473 (WNT3)
   05217 Basal cell carcinoma
    7473 (WNT3)
   05224 Breast cancer
    7473 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7473 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7473 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7473 (WNT3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7473 (WNT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7473
NCBI-ProteinID: NP_110380
OMIM: 165330
HGNC: 12782
Ensembl: ENSG00000108379
Vega: OTTHUMG00000178076
Pharos: P56703(Tchem)
UniProt: P56703
LinkDB All DBs
Structure
PDB: 

Position
17q21.31-q21.32
AA seq 355 aa AA seqDB search
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgttcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggcgtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggtgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccacggagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

KEGG   Homo sapiens (human): 7474Help
Entry
7474              CDS       T01001                                 

Gene name
WNT5A, hWNT5A
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00485  Robinow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7474 (WNT5A)
   04390 Hippo signaling pathway
    7474 (WNT5A)
   04150 mTOR signaling pathway
    7474 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7474 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7474 (WNT5A)
  09158 Development
   04360 Axon guidance
    7474 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7474 (WNT5A)
   05205 Proteoglycans in cancer
    7474 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7474 (WNT5A)
   05226 Gastric cancer
    7474 (WNT5A)
   05217 Basal cell carcinoma
    7474 (WNT5A)
   05224 Breast cancer
    7474 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7474 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7474 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7474 (WNT5A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7474 (WNT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7474
NCBI-ProteinID: NP_003383
OMIM: 164975
HGNC: 12784
Ensembl: ENSG00000114251
Vega: OTTHUMG00000158361
Pharos: P41221(Tbio)
UniProt: P41221 A0A384N611 B3KQX9
LinkDB All DBs
Position
3p14.3
AA seq 380 aa AA seqDB search
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctagtggctttggccatatttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcagacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtacaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccccagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgtggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Homo sapiens (human): 7475Help
Entry
7475              CDS       T01001                                 

Gene name
WNT6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7475 (WNT6)
   04390 Hippo signaling pathway
    7475 (WNT6)
   04150 mTOR signaling pathway
    7475 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7475 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7475 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7475 (WNT6)
   05205 Proteoglycans in cancer
    7475 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7475 (WNT6)
   05226 Gastric cancer
    7475 (WNT6)
   05217 Basal cell carcinoma
    7475 (WNT6)
   05224 Breast cancer
    7475 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7475 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7475 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7475 (WNT6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7475 (WNT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7475
NCBI-ProteinID: NP_006513
OMIM: 604663
HGNC: 12785
Ensembl: ENSG00000115596
Vega: OTTHUMG00000133082
Pharos: Q9Y6F9(Tbio)
UniProt: Q9Y6F9 Q8N2E5
LinkDB All DBs
Position
2q35
AA seq 365 aa AA seqDB search
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgcccttaccctcccgcctcgggctgctgctgctgctgctcctgtgcccggcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctaccagcatc
tgcaggaaggcacggcggctggccgggcggcaggccgagttgtgccaggctgagccggaa
gtggtggcagagctagctcggggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaattgctccagccacagcaaggcctttggacgcatcctgcaacag
gacattcgggagacggccttcgtgttcgccatcactgcggccggcgccagccacgccgtc
acgcaggcctgttctatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
gcccctccccggccctccggcctgcccggcacccccggaccccctggccccgcgggctcc
ccggaaggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggcaggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggatcatgcgcgctgcgcacctgctggcagaagctg
cctccatttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgccgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccccggcacgcgcggtcgcgcctgcaatagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgcttccactggtgctgcgtagtacagtgccaccgctgccgtgtgcgcaaggag
ctcagcctctgcctgtga

KEGG   Homo sapiens (human): 7476Help
Entry
7476              CDS       T01001                                 

Gene name
WNT7A, Wnt-7a
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00846  Fuhrmann syndrome
H00847  Al-Awadi/Raas-Rothschild syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7476 (WNT7A)
   04390 Hippo signaling pathway
    7476 (WNT7A)
   04150 mTOR signaling pathway
    7476 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7476 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7476 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7476 (WNT7A)
   05205 Proteoglycans in cancer
    7476 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7476 (WNT7A)
   05226 Gastric cancer
    7476 (WNT7A)
   05217 Basal cell carcinoma
    7476 (WNT7A)
   05224 Breast cancer
    7476 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7476 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7476 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7476 (WNT7A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7476 (WNT7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt COG6
Motif
Other DBs
NCBI-GeneID: 7476
NCBI-ProteinID: NP_004616
OMIM: 601570
HGNC: 12786
Ensembl: ENSG00000154764
Vega: OTTHUMG00000129803
Pharos: O00755(Tbio)
UniProt: O00755
LinkDB All DBs
Position
3p25.1
AA seq 349 aa AA seqDB search
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcgttcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaacaacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

KEGG   Homo sapiens (human): 7477Help
Entry
7477              CDS       T01001                                 

Gene name
WNT7B
Definition
(RefSeq) Wnt family member 7B
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7477 (WNT7B)
   04390 Hippo signaling pathway
    7477 (WNT7B)
   04150 mTOR signaling pathway
    7477 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7477 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7477 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7477 (WNT7B)
   05205 Proteoglycans in cancer
    7477 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7477 (WNT7B)
   05226 Gastric cancer
    7477 (WNT7B)
   05217 Basal cell carcinoma
    7477 (WNT7B)
   05224 Breast cancer
    7477 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7477 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7477 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7477 (WNT7B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7477 (WNT7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7477
NCBI-ProteinID: NP_478679
OMIM: 601967
HGNC: 12787
Ensembl: ENSG00000188064
Vega: OTTHUMG00000154636
Pharos: P56706(Tbio)
UniProt: P56706
LinkDB All DBs
Position
22q13.31
AA seq 349 aa AA seqDB search
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaaactttcgcaagtggattttctacgtgtttctctgctttggcgtcctgtac
gtgaagctcggagcactgtcatccgtggtggccctgggagccaacatcatctgcaacaag
attcctggcctagccccgcggcagcgtgccatctgccagagtcggcccgatgccatcatt
gtgattggggagggggcgcagatgggcatcaacgagtgccagtaccagttccgcttcgga
cgctggaactgctctgccctcggcgagaagaccgtcttcgggcaagagctccgagtaggg
agccgtgaggctgccttcacgtacgccatcaccgcggctggcgtggcgcacgccgtcacc
gctgcctgcagccaagggaacctgagcaactgcggctgcgaccgcgagaagcagggctac
tacaaccaagccgagggctggaagtggggcggctgctcggccgacgtgcgttacggcatc
gacttctcccggcgcttcgtggacgctcgggagatcaagaagaacgcgcggcgcctcatg
aacctgcataacaatgaggccggcaggaaggttctagaggaccggatgcagctggagtgc
aagtgccacggcgtgtctggctcctgcaccaccaaaacctgctggaccacgctgcccaag
ttccgagaggtgggccacctgctgaaggagaagtacaacgcggccgtgcaggtggaggtg
gtgcgggccagccgtctgcggcagcccaccttcctgcgcatcaaacagctgcgcagctat
cagaagcccatggagacagacctggtgtacattgagaagtcgcccaactactgcgaggag
gacgcggccacgggcagcgtgggcacgcagggccgtctctgcaaccgcacgtcgcccggc
gcggacggctgtgacaccatgtgctgcggccgaggctacaacacccaccagtacaccaag
gtgtggcagtgcaactgcaaattccactggtgctgcttcgtcaagtgcaacacctgcagc
gagcgcaccgaggtcttcacctgcaagtga

KEGG   Homo sapiens (human): 7478Help
Entry
7478              CDS       T01001                                 

Gene name
WNT8A, WNT8D
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7478 (WNT8A)
   04390 Hippo signaling pathway
    7478 (WNT8A)
   04150 mTOR signaling pathway
    7478 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7478 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7478 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7478 (WNT8A)
   05205 Proteoglycans in cancer
    7478 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7478 (WNT8A)
   05226 Gastric cancer
    7478 (WNT8A)
   05217 Basal cell carcinoma
    7478 (WNT8A)
   05224 Breast cancer
    7478 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7478 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7478 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7478 (WNT8A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7478 (WNT8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7478
NCBI-ProteinID: NP_490645
OMIM: 606360
HGNC: 12788
Ensembl: ENSG00000061492
Vega: OTTHUMG00000129196
Pharos: Q9H1J5(Tbio)
UniProt: Q9H1J5
LinkDB All DBs
Position
5q31.2
AA seq 351 aa AA seqDB search
MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEA
FLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQ
VEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacctgtttatgctctgggcagctctgggcatatgctgtgctgcattcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacacg
actagtgtggccttgggtgcccagagtggcatcgaggagtgcaagttccagtttgcttgg
gaacgctggaactgccctgaaaatgctcttcagctctccacccacaacaggctgagaagt
gctaccagagagacttccttcatacatgctatcagctctgctggagtcatgtacatcatc
accaagaactgtagcatgggtgacttcgaaaactgtggctgtgatgggtcaaacaatgga
aaaacaggaggccatggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatcttcacaacaacagggccggcagactggcagtgagagccaccatgaaaaggacatgc
aaatgtcatggcatctctgggagctgcagcatacagacatgctggctgcagctggctgaa
ttccgggagatgggagactacctaaaggccaagtatgaccaggcgctgaaaattgaaatg
gataagcggcagctgagagctgggaacagcgccgagggccactgggtgcccgctgaggcc
ttccttcctagcgcagaggcggaactgatctttttagaggaatcaccagattactgtacc
tgcaattccagcctgggcatctatggcacagagggtcgtgagtgcctacagaacagccac
aacacatccaggtgggagcgacgtagctgtgggcgcctgtgcactgagtgtgggctgcag
gtggaagagaggaaaactgaggtcataagcagctgtaactgcaaattccagtggtgctgt
acggtcaagtgtgaccagtgtaggcatgtggtgagcaagtattactgcgcacgctcccca
ggcagtgcccagtccctgggtaagggcagtgcctga

KEGG   Homo sapiens (human): 7479Help
Entry
7479              CDS       T01001                                 

Gene name
WNT8B
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7479 (WNT8B)
   04390 Hippo signaling pathway
    7479 (WNT8B)
   04150 mTOR signaling pathway
    7479 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7479 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7479 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7479 (WNT8B)
   05205 Proteoglycans in cancer
    7479 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7479 (WNT8B)
   05226 Gastric cancer
    7479 (WNT8B)
   05217 Basal cell carcinoma
    7479 (WNT8B)
   05224 Breast cancer
    7479 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7479 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7479 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7479 (WNT8B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7479 (WNT8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7479
NCBI-ProteinID: NP_003384
OMIM: 601396
HGNC: 12789
Ensembl: ENSG00000075290
Vega: OTTHUMG00000018912
Pharos: Q93098(Tbio)
UniProt: Q93098 A0A384NKY7
LinkDB All DBs
Position
10q24.31
AA seq 351 aa AA seqDB search
MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttcaaagccttctgtgtacatctgtcttttcacctgtgtcctccaactcagc
cacagctggtcggtgaacaatttcctgatgactggtccaaaggcttacctgatttactcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagccctgcagctgtccagccatggtgggcttcgcagt
gccaatcgggagacagcatttgtgcatgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaacggg
caactggggggacaaggctggctgtggggaggctgcagtgacaatgtgggcttcggagag
gcgatttccaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaacaacgaggctggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtggacctg
ctgcagggtgctggcaacagcgcggccggccgcggcgccatcgccgacacctttcgctcc
atctctacccgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
acgctagggctgctgggcaccgaaggccgagagtgcctaaggcgcgggcgggccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgccggagggtcaccaagtacttctgtagccgcgcagagcggccgcgg
gggggcgctgcgcacaaacccgggagaaaaccctaa

KEGG   Homo sapiens (human): 7480Help
Entry
7480              CDS       T01001                                 

Gene name
WNT10B, SHFM6, STHAG8, WNT-12
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00471  Split-hand/foot malformation
H00625  Tooth agenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7480 (WNT10B)
   04390 Hippo signaling pathway
    7480 (WNT10B)
   04150 mTOR signaling pathway
    7480 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7480 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7480 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7480 (WNT10B)
   05205 Proteoglycans in cancer
    7480 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7480 (WNT10B)
   05226 Gastric cancer
    7480 (WNT10B)
   05217 Basal cell carcinoma
    7480 (WNT10B)
   05224 Breast cancer
    7480 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7480 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7480 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7480 (WNT10B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7480 (WNT10B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7480
NCBI-ProteinID: NP_003385
OMIM: 601906
HGNC: 12775
Ensembl: ENSG00000169884
Vega: OTTHUMG00000150734
Pharos: O00744(Tbio)
UniProt: O00744
LinkDB All DBs
Position
12q13.12
AA seq 389 aa AA seqDB search
MLEEPRPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggagccccggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gcgttgtgcagtcgggctctaagcaatgagattctgggcctgaagttgcctggcgagccg
ccgctgacggccaacaccgtgtgcttgacgctgtccggcctgagcaagcggcagctaggc
ctgtgcctgcgcaaccccgacgtgacggcgtccgcgcttcagggtctgcacatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctccgcgcttgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagaaagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcagtagccacggcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccgaggcaagagtttcccccactctctgcccagccct
ggccctggctcaagccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgtcatggcacatcaggcagctgccagttcaagaca
tgctggagggcggccccagagttccgggcagtgggggcggcgttgagggagcggctgggc
cgggccatcttcattgatacccacaaccgcaattctggagccttccagccccgtctgcgt
ccccgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgagcga
gaccccactatgggctccccagggacaaggggccgggcctgcaacaagaccagccgcctg
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtgctccggcagacacga
gttgagcgctgccattgccgcttccactggtgctgctatgtgctgtgtgatgagtgcaag
gttacagagtgggtgaatgtgtgtaagtga

KEGG   Homo sapiens (human): 7481Help
Entry
7481              CDS       T01001                                 

Gene name
WNT11, HWNT11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7481 (WNT11)
   04390 Hippo signaling pathway
    7481 (WNT11)
   04150 mTOR signaling pathway
    7481 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7481 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7481 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7481 (WNT11)
   05205 Proteoglycans in cancer
    7481 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7481 (WNT11)
   05226 Gastric cancer
    7481 (WNT11)
   05217 Basal cell carcinoma
    7481 (WNT11)
   05224 Breast cancer
    7481 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7481 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7481 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7481 (WNT11)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7481 (WNT11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7481
NCBI-ProteinID: NP_004617
OMIM: 603699
HGNC: 12776
Ensembl: ENSG00000085741
Vega: OTTHUMG00000165264
Pharos: O96014(Tbio)
UniProt: O96014
LinkDB All DBs
Position
11q13.5
AA seq 354 aa AA seqDB search
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacaccatcggccctggcactgaac
cagacgcaacactgcaagcagctggagggtctggtgtctgcacaggtgcagctgtgccgc
agcaacctggagctcatgcacacggtggtgcacgccgcccgcgaggtcatgaaggcctgt
cgccgggcctttgccgacatgcgctggaactgctcctccattgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagctgcaggatgtggctgctgacctcaagacccga
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggatatccggcctgtgaaggactcggaactcgtctatctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccacgggacacaagacaggcagtgcaac
aagacatccaacggaagcgacagctgcgaccttatgtgctgcgggcgtggctacaacccc
tacacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctacgtcacc
tgccgcaggtgtgagcgtaccgtggagcgctatgtctgcaagtga

KEGG   Homo sapiens (human): 7482Help
Entry
7482              CDS       T01001                                 

Gene name
WNT2B, WNT13
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7482 (WNT2B)
   04390 Hippo signaling pathway
    7482 (WNT2B)
   04150 mTOR signaling pathway
    7482 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7482 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7482 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7482 (WNT2B)
   05205 Proteoglycans in cancer
    7482 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7482 (WNT2B)
   05226 Gastric cancer
    7482 (WNT2B)
   05217 Basal cell carcinoma
    7482 (WNT2B)
   05224 Breast cancer
    7482 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7482 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7482 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7482 (WNT2B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7482 (WNT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7482
NCBI-ProteinID: NP_078613
OMIM: 601968
HGNC: 12781
Ensembl: ENSG00000134245
Vega: OTTHUMG00000011157
Pharos: Q93097(Tbio)
UniProt: Q93097
LinkDB All DBs
Position
1p13.2
AA seq 391 aa AA seqDB search
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtccctgtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgcgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactacggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcgacgctatgatggggctgtgcaggtgatggccacccaagat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggacgtccatacttgcaaa
gcccccaagaaggcagagtggctggaccaaacctga

KEGG   Homo sapiens (human): 7483Help
Entry
7483              CDS       T01001                                 

Gene name
WNT9A, WNT14
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7483 (WNT9A)
   04390 Hippo signaling pathway
    7483 (WNT9A)
   04150 mTOR signaling pathway
    7483 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7483 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7483 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7483 (WNT9A)
   05205 Proteoglycans in cancer
    7483 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7483 (WNT9A)
   05226 Gastric cancer
    7483 (WNT9A)
   05217 Basal cell carcinoma
    7483 (WNT9A)
   05224 Breast cancer
    7483 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7483 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7483 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7483 (WNT9A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7483 (WNT9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7483
NCBI-ProteinID: NP_003386
OMIM: 602863
HGNC: 12778
Ensembl: ENSG00000143816
Vega: OTTHUMG00000037592
Pharos: O14904(Tbio)
UniProt: O14904 D9ZGG3
LinkDB All DBs
Position
1q42.13
AA seq 365 aa AA seqDB search
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgggtccccgctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctgacgggcagcgagcccctgacc
atcctcccgctgaccctggagccagaggcggctgcccaggcgcactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggcgtggcagag
acgctggtggaggccgtgagcatgagtgcgctcgagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagactgccttcctctatgccatctcctcggctggcctgacgcacgcactggccaaggcg
tgcagcgcgggccgcatggagcgctgtacctgcgatgaggcacccgacctggagaaccgt
gaggcctggcagtgggggggctgcggagacaaccttaagtacagcagcaagttcgtcaag
gaattcctgggcagacggtcaagcaaggatctgcgagcccgtgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacctgcaagtgccacggcgtg
tcaggctcatgcacggtgcggacctgctggcggcagttggcgcctttccatgaggtgggc
aagcatctgaagcacaagtatgagacggcactcaaggtgggcagcaccaccaatgaagct
gccggcgaggcaggtgccatctccccaccacggggccgtgcctcgggggcaggtggcagc
gacccgctgccccgcactccagagctggtgcacctggatgactcgcctagcttctgcctg
gctggccgcttctccccgggcaccgctggccgtaggtgccaccgtgagaagaactgcgag
agcatctgctgtggccgcggccataacacacagagccgggtggtgacaaggccctgccag
tgccaggtgcgttggtgctgctatgtggagtgcaggcagtgcacgcagcgtgaggaggtc
tacacctgcaagggctga

KEGG   Homo sapiens (human): 7484Help
Entry
7484              CDS       T01001                                 

Gene name
WNT9B, WNT14B, WNT15
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7484 (WNT9B)
   04390 Hippo signaling pathway
    7484 (WNT9B)
   04150 mTOR signaling pathway
    7484 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7484 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7484 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7484 (WNT9B)
   05205 Proteoglycans in cancer
    7484 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7484 (WNT9B)
   05226 Gastric cancer
    7484 (WNT9B)
   05217 Basal cell carcinoma
    7484 (WNT9B)
   05224 Breast cancer
    7484 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7484 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7484 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7484 (WNT9B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7484 (WNT9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7484
NCBI-ProteinID: NP_003387
OMIM: 602864
HGNC: 12779
Ensembl: ENSG00000158955
Vega: OTTHUMG00000178077
Pharos: O14905(Tbio)
UniProt: O14905
LinkDB All DBs
Position
17q21.32
AA seq 357 aa AA seqDB search
MRPPPALALAGLCLLALPAAAASYFGLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRMGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
RGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgggctctgcctgctggcgctgcccgccgcc
gccgcctcctacttcggcctgaccgggcgggaagtcctgacgcccttcccaggattgggc
actgcggcagccccggcacagggcggggcccacctgaagcagtgtgacctgctgaagctg
tcccggcggcagaagcagctctgccggagggagcccggcctggctgagaccctgagggat
gctgcgcacctcggcctgcttgagtgccagtttcagttccggcatgagcgctggaactgt
agcctggagggcaggatgggcctgctcaagagaggcttcaaagagacagctttcctgtac
gcggtgtcctctgccgccctcacccacaccctggcccgggcctgcagcgctgggcgcatg
gagcgctgcacctgtgatgactctccggggctggagagccggcaggcctggcagtggggc
gtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctggggtccaag
agaggaaacaaggacctgcgggcacgggcagacgcccacaatacccacgtgggcatcaag
gctgtgaagagtggcctcaggaccacgtgtaagtgccatggcgtatcaggctcctgtgcc
gtgcgcacctgctggaagcagctctccccgttccgtgagacgggccaggtgctgaaactg
cgctatgactcggctgtcaaggtgtccagtgccaccaatgaggccttgggccgcctagag
ctgtgggcccctgccaggcagggcagcctcaccaaaggcctggccccaaggtctggggac
ctggtgtacatggaggactcacccagcttctgccggcccagcaagtactcacctggcaca
gcaggtagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcggggctat
gacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgctac
gtggagtgccagcaatgtgtgcaggaggagcttgtgtacacctgcaagcactag

KEGG   Homo sapiens (human): 80326Help
Entry
80326             CDS       T01001                                 

Gene name
WNT10A, OODD, SSPS, STHAG4
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00625  Tooth agenesis
H00646  Odontoonychodermal dysplasia
H00781  Schopf-Schulz-Passarge syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    80326 (WNT10A)
   04390 Hippo signaling pathway
    80326 (WNT10A)
   04150 mTOR signaling pathway
    80326 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    80326 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    80326 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80326 (WNT10A)
   05205 Proteoglycans in cancer
    80326 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    80326 (WNT10A)
   05226 Gastric cancer
    80326 (WNT10A)
   05217 Basal cell carcinoma
    80326 (WNT10A)
   05224 Breast cancer
    80326 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    80326 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    80326 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    80326 (WNT10A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   80326 (WNT10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt Ebola_NP
Motif
Other DBs
NCBI-GeneID: 80326
NCBI-ProteinID: NP_079492
OMIM: 606268
HGNC: 13829
Ensembl: ENSG00000135925
Vega: OTTHUMG00000133085
Pharos: Q9GZT5(Tbio)
UniProt: Q9GZT5 A0A2K8FR47
LinkDB All DBs
Position
2q35
AA seq 417 aa AA seqDB search
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccagccccagccgcggcca
gcgctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcccgtgctcaatgccaacacagtg
tgcctaacattgccaggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgat
gtggctgcctcagccatacagggcatccagatcgccatccacgaatgccaacaccaattc
agggaccagcgctggaactgctcaagcctggagactcgcaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagcgcttttgcctacgccatcgcagcagctggc
gtggtgcacgccgtgtccaatgcgtgtgccctgggcaaactgaaggcctgtggctgtgat
gcgtcccggcgaggggacgaggaggccttccgtaggaagctgcaccgcttacaactggat
gcactgcagcgtggtaagggcctgagccatggggtcccggaacacccagccctgcccaca
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacatgggcttc
ggggagcgcttttctaaggactttctggactcccgggagcctcacagagacatccacgcg
agaatgaggcttcacaacaaccgagttgggaggcaggcagtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggcccagcgggggcaccctcgccg
gctccgggcgctcccgggccgcgccgacgggccagccccgccgacctggtctacttcgaa
aagtctcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgccggctcggatggctgcggcagcatgtgctgcggccgcggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgt
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Homo sapiens (human): 81029Help
Entry
81029             CDS       T01001                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    81029 (WNT5B)
   04390 Hippo signaling pathway
    81029 (WNT5B)
   04150 mTOR signaling pathway
    81029 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81029 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    81029 (WNT5B)
  09158 Development
   04360 Axon guidance
    81029 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81029 (WNT5B)
   05205 Proteoglycans in cancer
    81029 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81029 (WNT5B)
   05226 Gastric cancer
    81029 (WNT5B)
   05217 Basal cell carcinoma
    81029 (WNT5B)
   05224 Breast cancer
    81029 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81029 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81029 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    81029 (WNT5B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   81029 (WNT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 81029
NCBI-ProteinID: NP_110402
OMIM: 606361
HGNC: 16265
Ensembl: ENSG00000111186
Vega: OTTHUMG00000090375
Pharos: Q9H1J7(Tbio)
UniProt: Q9H1J7
LinkDB All DBs
Position
12p13.33
AA seq 359 aa AA seqDB search
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaattgcagcacagcggacaacgca
tctgtctttgggagagtcatgcagataggcagccgagagaccgccttcacccacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagcgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctat
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaggtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

KEGG   Homo sapiens (human): 89780Help
Entry
89780             CDS       T01001                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    89780 (WNT3A)
   04390 Hippo signaling pathway
    89780 (WNT3A)
   04150 mTOR signaling pathway
    89780 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    89780 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    89780 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89780 (WNT3A)
   05206 MicroRNAs in cancer
    89780 (WNT3A)
   05205 Proteoglycans in cancer
    89780 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    89780 (WNT3A)
   05226 Gastric cancer
    89780 (WNT3A)
   05217 Basal cell carcinoma
    89780 (WNT3A)
   05224 Breast cancer
    89780 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    89780 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    89780 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    89780 (WNT3A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   89780 (WNT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 89780
NCBI-ProteinID: NP_149122
OMIM: 606359
HGNC: 15983
Ensembl: ENSG00000154342
Vega: OTTHUMG00000037593
Pharos: P56704(Tchem)
UniProt: P56704
LinkDB All DBs
Position
1q42.13
AA seq 352 aa AA seqDB search
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccccactcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcggcctttgtccacgccattgcctcagccggtgtg
gcctttgcagtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccctgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system