KEGG   Homo sapiens (human): 5139
Entry
5139              CDS       T01001                                 

Gene name
PDE3A, CGI-PDE, CGI-PDE_A, CGI-PDE-A, HTNB
Definition
(RefSeq) phosphodiesterase 3A
  KO
K19021  cGMP-inhibited 3',5'-cyclic phosphodiesterase A [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04924  Renin secretion
hsa05032  Morphine addiction
Disease
H00482  Brachydactyly
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255<JP/US>
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilostazol: D01896<JP/US>
Diprophylline: D00691<JP>
Enoximone: D04004
Enprofylline: D04006
Ensifentrine: D11743
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417<JP> D02085<US>
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042<JP> D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Pimobendan: D01133<JP>
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220<JP>
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5139 (PDE3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5139 (PDE3A)
   04022 cGMP-PKG signaling pathway
    5139 (PDE3A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5139 (PDE3A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5139 (PDE3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5139 (PDE3A)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 5139
NCBI-ProteinID: NP_000912
OMIM: 123805
HGNC: 8778
Ensembl: ENSG00000172572
Vega: OTTHUMG00000168962
Pharos: Q14432(Tclin)
UniProt: Q14432
LinkDB
Position
12p12.2
AA seq 1141 aa
MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEDIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIN
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPD
Q
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggcagtgcccggcgacgctgcacgagtcagggacaagcccgtccacagtggggtgagt
caagcccccacggcgggccgggactgccaccatcgtgcggaccccgcatcgccgcgggac
tcgggctgccgtggctgctggggagacctggtgctgcagccgctccggagctctcggaaa
ctttcctccgcgctgtgcgcgggctccctgtcctttctgctggcgctgctggtgaggctg
gtccgcggggaggtcggctgtgacctggagcagtgtaaggaggcggcggcggcggaggag
gaggaagcagccccgggagcagaagggggcgtcttcccggggcctcggggaggtgctccc
gggggcggtgcgcggctcagcccctggctgcagccctcggcgctgctcttcagtctcctg
tgtgccttcttctggatgggcttgtacctcctgcgcgccggggtgcgcctgcctctggct
gtcgcgctgctggccgcctgctgcgggggggaagcgctcgtccagattgggctgggcgtc
ggggaggatcacttactctcactccccgccgcgggggtggtgctcagctgcttggccgcc
gcgacatggctggtgctgaggctgaggctgggcgtcctcatgatcgccttgactagcgcg
gtcaggaccgtgtccctcatttccttagagaggttcaaggtcgcctggagaccttacctg
gcgtacctggccggcgtgctggggatcctcttggccaggtacgtggaacaaatcttgccg
cagtccgcggaggcggctccaagggagcatttggggtcccagctgattgctgggaccaag
gaagatatcccggtgtttaagaggaggaggcggtccagctccgtcgtgtccgccgagatg
tccggctgcagcagcaagtcccatcggaggacctccctgccctgtataccgagggaacag
ctcatggggcattcagaatgggaccacaaacgagggccaagaggatcacagtcttcagga
accagtattactgtggacatcgccgtcatgggcgaggcccacggcctcattaccgacctc
ctggcagacccttctcttccaccaaacgtgtgcacatccttgagagccgtgagcaacttg
ctcagcacacagctcaccttccaggccattcacaagcccagagtgaatcccgtcacttcg
ctcagtgaaaactatacctgttctgactctgaagagagctctgaaaaagacaagcttgct
attccaaagcgcctgagaaggagtttgcctcctggcttgttgagacgagtttcttccact
tggaccaccaccacctcggccacaggtctacccaccttggagcctgcaccagtacggaga
gaccgcagcaccagcatcaaactgcaggaagcaccttcatccagtcctgattcttggaat
aatccagtgatgatgaccctcaccaaaagcagatcctttacttcatcctatgctatttct
gcagctaaccatgtaaaggctaaaaagcaaagtcgaccaggtgccctcgctaaaatttca
cctctttcatcgccctgctcctcacctctccaagggactcctgccagcagcctggtcagc
aaaatttctgcagtgcagtttccagaatctgctgacacaactgccaaacaaagcctaggt
tctcacagggccttaacttacactcagagtgccccagacctatcccctcaaatcctgact
ccacctgttatatgtagcagctgtggcagaccatattcccaagggaatcctgctgatgag
cccctggagagaagtggggtagccactcggacaccaagtagaacagatgacactgctcaa
gttacctctgattatgaaaccaataacaacagtgacagcagtgacattgtacagaatgaa
gatgaaacagagtgcctgagagagcctctgaggaaagcatcggcttgcagcacctatgct
cctgagaccatgatgtttctggacaaaccaattcttgctcccgaacctcttgtcatggat
aacctggactcaattatggagcagctaaatacttggaattttccaatttttgatttagtg
gaaaatataggaagaaaatgtggccgtattcttagtcaggtatcttacagactttttgaa
gacatgggcctctttgaagcttttaaaattccaattagggaatttatgaattattttcat
gctttggagattggatatagggatattccttatcataacagaatccatgccactgatgtt
ttacatgctgtttggtatcttactacacagcctattccaggcctctcaactgtgattaat
gatcatggttcaaccagtgattcagattctgacagtggatttacacatggacatatggga
tatgtattctcaaaaacgtataatgtgacagatgataaatacggatgtctgtctgggaat
atccctgccttggagttgatggcgctgtatgtggctgcagccatgcacgattatgatcat
ccaggaaggactaatgctttcctggttgcaactagtgctcctcaggcggtgctatataac
gatcgttcagttttggagaatcatcacgcagctgctgcatggaatcttttcatgtcccgg
ccagagtataacttcttaattaaccttgaccatgtggaatttaagcatttccgtttcctt
gtcattgaagcaattttggccactgacctgaagaaacactttgacttcgtagccaaattt
aatggcaaggtaaatgatgatgttggaatagattggaccaatgaaaatgatcgtctactg
gtttgtcaaatgtgtataaagttggctgatatcaatggtccagctaaatgtaaagaactc
catcttcagtggacagatggtattgtcaatgaattttatgaacagggtgatgaagaggcc
agccttggattacccataagccccttcatggatcgttctgctcctcagctggccaacctt
caggaatccttcatctctcacattgtggggcctctgtgcaactcctatgattcagcagga
ctaatgcctggaaaatgggtggaagacagcgatgagtcaggagatactgatgacccagaa
gaagaggaggaagaagcaccagcaccaaatgaagaggaaacctgtgaaaataatgaatct
ccaaaaaagaagactttcaaaaggagaaaaatctactgccaaataactcagcacctctta
cagaaccacaagatgtggaagaaagtcattgaagaggagcaacggttggcaggcatagaa
aatcaatccctggaccagacccctcagtcgcactcttcagaacagatccaggctatcaag
gaagaagaagaagagaaagggaaaccaagaggcgaggagataccaacccaaaagccagac
cagtga

KEGG   Homo sapiens (human): 5140
Entry
5140              CDS       T01001                                 

Gene name
PDE3B, HcGIP1, cGIPDE1
Definition
(RefSeq) phosphodiesterase 3B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04371  Apelin signaling pathway
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255<JP/US>
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilostazol: D01896<JP/US>
Diprophylline: D00691<JP>
Enoximone: D04004
Enprofylline: D04006
Ensifentrine: D11743
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417<JP> D02085<US>
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042<JP> D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Pimobendan: D01133<JP>
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771<JP>
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220<JP>
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5140 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5140 (PDE3B)
   04024 cAMP signaling pathway
    5140 (PDE3B)
   04022 cGMP-PKG signaling pathway
    5140 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5140 (PDE3B)
   04922 Glucagon signaling pathway
    5140 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    5140 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    5140 (PDE3B)
   04924 Renin secretion
    5140 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5140 (PDE3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5140 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 5140
NCBI-ProteinID: NP_000913
OMIM: 602047
HGNC: 8779
Ensembl: ENSG00000152270
Vega: OTTHUMG00000165898
Pharos: Q13370(Tclin)
UniProt: Q13370 A7E2E5
LinkDB
Structure
PDB: 
1SO2 1SOJ

Position
11p15.2
AA seq 1112 aa
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
NT seq 3339 nt   +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagccgccggatggggcc
ggctcgccccccgagagtctgaggaacggctacgtgaagagctgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctctccccagcagccgcggcgctgctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcttgagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagctgcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggtcttggccttggggggatggcgac
gcagggtccgcggccccgcacacgcccccggaggcggcagcgggcaggttgctgctggtg
ctgagctgcgtagggctgctgctgacgctcgcgcacccgctgcggctccggcactgcgtt
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgccctcaggccgctgctctccggcctggtggggggcgctggctgcctgctggcc
ctggggttggatcacttctttcaaatcagggaagcgcctcttcatcctcgactgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgtta
ggagaaactgcagccagttactatggcagttgcaaaatattcaggagaccgtcgttgcct
tgtatttccagagaacagatgattctttgggattgggacttaaaacaatggtataagcct
cattatcaaaattctggaggtggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctgactgatccaagccttccaccacaagtcatttcctctcta
cggagtattagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacaccatttcctggattttacccctgttctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagtttgccaactccacagctgaggaga
agctcaggaacttcaggattgctacctgttgaacagtcttcaaggtgggatcgtaataat
ggcaaaagacctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctcagaagagctggtgttttgtccagtctgagtcctgtgaattcttccaac
catggaccagtgtctactggctctctaactaatcgatcacccatagaatttcctgatact
gctgattttcttaataagccaagcgttatcttgcagagatctctgggcaatgcacctaat
actccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacagctgtgga
catcaaatgctgaaatatgtttcaacatctgaatcagatggtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcgaaagaatcattcaaacttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataagtgg
ctaacagaagaggcacagagtgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagaaaagatgagcaactggaattttcca
atttttgaacttgtagaaaagatgggagagaaatcaggaaggattctcagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtgctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
catgggcgaattgcttatatttcttcgaagagctgctctaatcctgatgagagttatggc
tgcctgtcttcaaacattcctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacaaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcattgaagcaatccttgctacggatcttaaaaagcattttgat
tttctcgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatcttggtctgcccatcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggttagaagcagaagaggataat
gatactgaaagtggtgatgatgaagacggtgaagaattagatacagaagatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcgaatattttgtcag
ctaatgcaccacctcactgaaaaccacaagatatggaaggaaatcgtagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtaattgaagaggcagatgaagaggaatag

DBGET integrated database retrieval system