KEGG   Homo sapiens (human): 51422Help
Entry
51422             CDS       T01001                                 

Gene name
PRKAG2, AAKG, AAKG2, CMH6, H91620p, WPWS
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Disease
H00069  Glycogen storage disease
H00292  Hypertrophic cardiomyopathy
H01154  Wolff-Parkinson-White (WPW) syndrome
H01956  Glycogen storage disease of heart
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    51422 (PRKAG2)
   04068 FoxO signaling pathway
    51422 (PRKAG2)
   04152 AMPK signaling pathway
    51422 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51422 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    51422 (PRKAG2)
   04922 Glucagon signaling pathway
    51422 (PRKAG2)
   04920 Adipocytokine signaling pathway
    51422 (PRKAG2)
   04921 Oxytocin signaling pathway
    51422 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    51422 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    51422 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    51422 (PRKAG2)
   04714 Thermogenesis
    51422 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    51422 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51422 (PRKAG2)
   04931 Insulin resistance
    51422 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 51422
NCBI-ProteinID: NP_057287
OMIM: 602743
HGNC: 9386
Ensembl: ENSG00000106617
Vega: OTTHUMG00000157324
Pharos: Q9UGJ0(Tbio)
UniProt: Q9UGJ0 A0A090N8Q6
LinkDB All DBs
Position
7q36.1
AA seq 569 aa AA seqDB search
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcggttatggacaccaagaagaaaaaagatgtttccagccccggcgggagc
ggcggcaagaaaaatgccagccagaagaggcgttcgctgcgcgtgcacattccggacctg
agctccttcgccatgccgctcctggacggagacctggagggttccggaaagcattcctct
cgaaaggtggacagccccttcggcccgggcagcccctccaaagggttcttctccagaggc
ccccagccccggccctccagccccatgtctgcacctgtgaggcccaagaccagccccggc
tctcccaaaaccgtgttcccgttctcctaccaggagtccccgccacgctcccctcgacgc
atgagcttcagtgggatcttccgctcctcctccaaagagtcttcccccaactccaaccct
gctacctcgcccgggggcatcaggtttttctcccgctccagaaaaacctccggcctctcc
tcctctccgtcaacacccacccaagtgaccaagcagcacacgtttcccctggaatcctat
aagcacgagcctgaacggttagagaatcgcatctatgcctcgtcttcccccccggacaca
gggcagaggttctgcccgtcttccttccagagcccgaccaggcctccactggcatcaccg
acacactatgctccctccaaagccgcggcgctggcggcggccctgggacccgcggaagcc
ggcatgctggagaagctggagttcgaggacgaagcagtagaagactcagaaagtggtgtt
tacatgcgattcatgaggtcacacaagtgttatgacatcgttccaaccagttcaaagctt
gttgtctttgatactacattacaagttaaaaaggccttctttgctttggtagccaacggt
gtccgagcagcgccactgtgggagagtaaaaaacaaagttttgtaggaatgctaacaatt
acagatttcataaatatactacatagatactataaatcacctatggtacagatttatgaa
ttagaggaacataaaattgaaacatggagggagctttatttacaagaaacatttaagcct
ttagtgaatatatctccagatgcaagcctcttcgatgctgtatactccttgatcaaaaat
aaaatccacagattgcccgttattgaccctatcagtgggaatgcactttatatacttacc
cacaaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttc
atgaagcagaacctggatgagcttggaataggaacgtaccacaacattgccttcatacat
ccagacactcccatcatcaaagccttgaacatatttgtggaaagacgaatatcagctctg
cctgttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaat
cttgctgctgagaaaacatacaataacctagatatcacggtgacccaggcccttcagcac
cgttcacagtattttgaaggtgttgtgaagtgcaataagctggaaatactggagaccatc
gtggacagaatagtaagagctgaggtccatcggctggtggtggtaaatgaagcagatagt
attgtgggtattatttccctgtcggacattctgcaagccctgatcctcacaccagcaggt
gccaaacaaaaggagacagaaacggagtga

KEGG   Homo sapiens (human): 53632Help
Entry
53632             CDS       T01001                                 

Gene name
PRKAG3, AMPKG3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    53632 (PRKAG3)
   04068 FoxO signaling pathway
    53632 (PRKAG3)
   04152 AMPK signaling pathway
    53632 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53632 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    53632 (PRKAG3)
   04922 Glucagon signaling pathway
    53632 (PRKAG3)
   04920 Adipocytokine signaling pathway
    53632 (PRKAG3)
   04921 Oxytocin signaling pathway
    53632 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    53632 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    53632 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    53632 (PRKAG3)
   04714 Thermogenesis
    53632 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    53632 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    53632 (PRKAG3)
   04931 Insulin resistance
    53632 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 53632
NCBI-ProteinID: NP_059127
OMIM: 604976
HGNC: 9387
Ensembl: ENSG00000115592
Vega: OTTHUMG00000133078
Pharos: Q9UGI9(Tbio)
UniProt: Q9UGI9 A0A024R426
LinkDB All DBs
Position
2q35
AA seq 489 aa AA seqDB search
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgggctggagcacgcactgcgcaggaccccttcctggagcagccttgggggt
tctgagcatcaagagatgagcttcctagagcaagaaaacagcagctcatggccatcacca
gctgtgaccagcagctcagaaagaatccgtgggaaacggagggccaaagccttgagatgg
acaaggcagaagtcggtggaggaaggggagccaccaggtcagggggaaggtccccggtcc
aggccagctgctgagtccaccgggctggaggccacattccccaagaccacacccttggct
caagctgatcctgccggggtgggcactccaccaacagggtgggactgcctcccctctgac
tgtacagcctcagctgcaggctccagcacagatgatgtggagctggccacggagttccca
gccacagaggcctgggagtgtgagctagaaggcctgctggaagagaggcctgccctgtgc
ctgtccccgcaggccccatttcccaagctgggctgggatgacgaactgcggaaacccggc
gcccagatctacatgcgcttcatgcaggagcacacctgctacgatgccatggcaactagc
tccaagctagtcatcttcgacaccatgctggagatcaagaaggccttctttgctctggtg
gccaacggtgtgcgggcagcccctctatgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtcccccctggtccag
atctatgagattgaacaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtctccatctctcctaatgatagcctgtttgaagctgtctacaccctc
atcaagaaccggatccatcgcctgcctgttcttgacccggtgtcaggcaacgtactccac
atcctcacacacaaacgcctgctcaagttcctgcacatctttggttccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacattccgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggaccggcgtgtg
tctgcactgcctgtggtcaacgaatgtggtcaggtcgtgggcctctattcccgctttgat
gtgattcacctggctgcccagcaaacctacaaccacctggacatgagtgtgggagaagcc
ctgaggcagaggacactatgtctggagggagtcctttcctgccagccccacgagagcttg
ggggaagtgatcgacaggattgctcgggagcaggtacacaggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcatcgatgccctcggggcctga

KEGG   Homo sapiens (human): 5562Help
Entry
5562              CDS       T01001                                 

Gene name
PRKAA1, AMPK, AMPKa1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Buformin (DG00114): D00595 D02206
Metformin (DG00113): D00944 D04966
Phenformin (DG00112): D08351 D08352
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5562 (PRKAA1)
   04068 FoxO signaling pathway
    5562 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    5562 (PRKAA1)
   04152 AMPK signaling pathway
    5562 (PRKAA1)
   04150 mTOR signaling pathway
    5562 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5562 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5562 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5562 (PRKAA1)
   04922 Glucagon signaling pathway
    5562 (PRKAA1)
   04920 Adipocytokine signaling pathway
    5562 (PRKAA1)
   04921 Oxytocin signaling pathway
    5562 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    5562 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    5562 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5562 (PRKAA1)
   04714 Thermogenesis
    5562 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5562 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    5562 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5562 (PRKAA1)
   04931 Insulin resistance
    5562 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5562 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5562 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5562 (PRKAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5562 (PRKAA1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   5562 (PRKAA1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5562 (PRKAA1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    5562 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    5562 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 5562
NCBI-ProteinID: NP_006242
OMIM: 602739
HGNC: 9376
Ensembl: ENSG00000132356
Vega: OTTHUMG00000162269
Pharos: Q13131(Tchem)
UniProt: Q13131
LinkDB All DBs
Structure
PDB: 

Position
5p13.1
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacattctgggtgacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagtagctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggctggatgaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaagtttgagtgctcagaagaggaagttctcagc
tgtctttacaacagaaatcaccaggatcctttggcagttgcctaccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcatcacctgactcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatacccttgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgaccaaatgatatt
atggcagaagtatgtagagcaatcaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactccaaaatgagtcta
cagttataccaagtggatagtagaacttatctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

KEGG   Homo sapiens (human): 5563Help
Entry
5563              CDS       T01001                                 

Gene name
PRKAA2, AMPK, AMPK2, AMPKa2, PRKAA
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Buformin (DG00114): D00595 D02206
Metformin (DG00113): D00944 D04966
Phenformin (DG00112): D08351 D08352
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5563 (PRKAA2)
   04068 FoxO signaling pathway
    5563 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    5563 (PRKAA2)
   04152 AMPK signaling pathway
    5563 (PRKAA2)
   04150 mTOR signaling pathway
    5563 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5563 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5563 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5563 (PRKAA2)
   04922 Glucagon signaling pathway
    5563 (PRKAA2)
   04920 Adipocytokine signaling pathway
    5563 (PRKAA2)
   04921 Oxytocin signaling pathway
    5563 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    5563 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    5563 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5563 (PRKAA2)
   04714 Thermogenesis
    5563 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5563 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    5563 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5563 (PRKAA2)
   04931 Insulin resistance
    5563 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5563 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5563 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    5563 (PRKAA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5563 (PRKAA2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   5563 (PRKAA2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5563 (PRKAA2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    5563 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    5563 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 5563
NCBI-ProteinID: NP_006243
OMIM: 600497
HGNC: 9377
Ensembl: ENSG00000162409
Vega: OTTHUMG00000008282
Pharos: P54646(Tchem)
UniProt: P54646
LinkDB All DBs
Structure
PDB: 

Position
1p32.2
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQR
SGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtgctgggcgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattaacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgtcatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggaggtgaa
ttatttgactacatctgtaagcatggacgggttgaagagatggaagccaggcggctcttt
cagcagattctgtctgctgtggattactgtcataggcatatggttgttcatcgagacctg
aaaccagagaatgtcctgttggatgcacacatgaatgccaagatagccgatttcggatta
tctaatatgatgtcagatggtgaatttctgagaactagttgcggatctccaaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttatcttgtatgctcttctttgtggcaccctcccatttgatgatgagcatgtacct
acgttatttaagaagatccgagggggtgtcttttatatcccagaatatctcaatcgttct
gtcgccactctcctgatgcatatgctgcaggttgacccactgaaacgagcaactatcaaa
gacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccttcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gaatgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcctccatctggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagccccaaagca
agatgtccattggatgcactgaatacgactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatccgaagtcagagcaaaccgtatgacattatggctgaagtttac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaagaaaaaatccagtgactggcaattacgtgaaaatgagcttacaactttacctggtt
gataacaggagctatcttttggactttaaaagcattgatgatgaagtagtggagcagaga
tctggttcctcaacacctcagcgttcctgttctgctgctggcttacacagaccaagatca
agttttgattccacaactgcagagagccattcactttctggctctctcactggctctttg
accggaagcacattgtcttcagtttcacctcgcctgggcagtcacaccatggattttttt
gaaatgtgtgccagtctgattactactttagcccgttga

KEGG   Homo sapiens (human): 5564Help
Entry
5564              CDS       T01001                                 

Gene name
PRKAB1, AMPK, HAMPKb
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5564 (PRKAB1)
   04068 FoxO signaling pathway
    5564 (PRKAB1)
   04152 AMPK signaling pathway
    5564 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5564 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5564 (PRKAB1)
   04922 Glucagon signaling pathway
    5564 (PRKAB1)
   04920 Adipocytokine signaling pathway
    5564 (PRKAB1)
   04921 Oxytocin signaling pathway
    5564 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    5564 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    5564 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5564 (PRKAB1)
   04714 Thermogenesis
    5564 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    5564 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5564 (PRKAB1)
   04931 Insulin resistance
    5564 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 5564
NCBI-ProteinID: NP_006244
OMIM: 602740
HGNC: 9378
Ensembl: ENSG00000111725
Vega: OTTHUMG00000168954
Pharos: Q9Y478(Tbio)
UniProt: Q9Y478 A0A024RBN1
LinkDB All DBs
Structure
PDB: 

Position
12q24.23
AA seq 270 aa AA seqDB search
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataccagcagtgagcgcgccgcgctggagcggcatggtggccataagacgccc
cggagggacagctcggggggcaccaaggacggggacaggcccaagatcctgatggacagc
cccgaagacgccgacctcttccactccgaggaaatcaaggcaccagagaaggaggaattc
ctggcctggcagcatgatctggaagtgaatgataaagctcccgcccaggctcggccaacg
gtgtttcgatggacggggggcggaaaggaagtttacttatctgggtccttcaacaactgg
agtaaacttcccctcaccagaagccacaataactttgtagccatcctggatctgccggaa
ggagagcatcagtacaagttctttgtggatggtcagtggacgcacgacccttccgagccc
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agttctcccccaggaccctaccatcaggagccctacgtctgcaaacccgaagagcgcttt
cgggcaccccctattctccccccacatctcctccaggtcatcctgaacaaggacacgggg
atttcctgtgatccagctttgcttcctgagcccaatcacgtcatgctgaaccacctatac
gcgctgtctatcaaggatggagtgatggtgctcagcgcaacccaccggtacaagaagaag
tacgtcaccaccttgttatacaagcccatatga

KEGG   Homo sapiens (human): 5565Help
Entry
5565              CDS       T01001                                 

Gene name
PRKAB2
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5565 (PRKAB2)
   04068 FoxO signaling pathway
    5565 (PRKAB2)
   04152 AMPK signaling pathway
    5565 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5565 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5565 (PRKAB2)
   04922 Glucagon signaling pathway
    5565 (PRKAB2)
   04920 Adipocytokine signaling pathway
    5565 (PRKAB2)
   04921 Oxytocin signaling pathway
    5565 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    5565 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    5565 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5565 (PRKAB2)
   04714 Thermogenesis
    5565 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    5565 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5565 (PRKAB2)
   04931 Insulin resistance
    5565 (PRKAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 5565
NCBI-ProteinID: NP_005390
OMIM: 602741
HGNC: 9379
Ensembl: ENSG00000131791
Vega: OTTHUMG00000014032
Pharos: O43741(Tbio)
UniProt: O43741
LinkDB All DBs
Structure
PDB: 

Position
1q21.1
AA seq 272 aa AA seqDB search
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtgtccggggagcgccacggcgccaaggctgcacgc
tccgagggcgcaggcggccatgccccggggaaggagcacaagatcatggtggggagtacg
gacgaccccagcgtgttcagcctccctgactccaagctccctggggacaaagagtttgta
tcatggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcctggacctccctgag
ggagagcaccaatacaagttctttgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagcttggcacaattaacaatttgatccatgtcaagaaatctgatttt
gaggtgttcgatgctttaaagttagattctatggaaagttctgagacatcttgtagagac
ctttccagctcacccccagggccttatggtcaagaaatgtatgcgtttcgatctgaggaa
agattcaaatccccacccatccttcctcctcatctacttcaagttattcttaacaaagac
actaatatttcttgtgacccagccttactccctgagcccaaccatgttatgctgaaccat
ctctatgcattgtccattaaggacagtgtgatggtccttagcgcaacccatcgctacaag
aagaagtatgttactactctgctatacaagcccatttga

KEGG   Homo sapiens (human): 5571Help
Entry
5571              CDS       T01001                                 

Gene name
PRKAG1, AMPKG
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5571 (PRKAG1)
   04068 FoxO signaling pathway
    5571 (PRKAG1)
   04152 AMPK signaling pathway
    5571 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5571 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5571 (PRKAG1)
   04922 Glucagon signaling pathway
    5571 (PRKAG1)
   04920 Adipocytokine signaling pathway
    5571 (PRKAG1)
   04921 Oxytocin signaling pathway
    5571 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    5571 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    5571 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5571 (PRKAG1)
   04714 Thermogenesis
    5571 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    5571 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5571 (PRKAG1)
   04931 Insulin resistance
    5571 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 5571
NCBI-ProteinID: NP_002724
OMIM: 602742
HGNC: 9385
Ensembl: ENSG00000181929
Vega: OTTHUMG00000170406
Pharos: P54619(Tbio)
UniProt: P54619 A0A024R125
LinkDB All DBs
Structure
PDB: 

Position
12q13.12
AA seq 331 aa AA seqDB search
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtcatttcttcagatagctccccagctgtggaaaatgagcatcctcaagag
accccagaatccaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacgtccctgcaggtgaagaaagct
ttttttgctttggtgactaacggtgtacgagctgcccctttatgggatagtaagaagcaa
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgctactataaa
tcagccttggtacagatctatgagctagaagaacacaagatagaaacttggagagaggtg
tatctccaggactcctttaaaccgcttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcggaacaagatccacaggctgccagttattgacccagaatca
ggcaatactttgtacatcctcacccacaagcgcattctgaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtccaagtctctggaagagctacagattggcacc
tatgccaatattgctatggttcgcactaccacccccgtctatgtggctctggggattttt
gtacagcatcgagtctcagccctgccagtggtggatgagaaggggcgtgtggtggacatc
tactccaagtttgatgttatcaatctggcagcagaaaagacctacaacaacctagatgta
tctgtgactaaagccttgcaacatcgatcacattactttgagggtgttctcaagtgctac
ctgcatgagactctggagaccatcatcaacaggctagtggaagcagaggttcaccgactt
gtagtggtggatgaaaatgatgtggtcaagggaattgtatcactgtctgacatcctgcag
gccctggtgctcacaggtggagagaagaagccctga

DBGET integrated database retrieval system