KEGG   Homo sapiens (human): 51422Help
Entry
51422             CDS       T01001                                 

Gene name
PRKAG2, AAKG, AAKG2, CMH6, H91620p, WPWS
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Disease
H00069  Glycogen storage disease
H00292  Hypertrophic cardiomyopathy
H01154  Wolff-Parkinson-White (WPW) syndrome
H01956  Glycogen storage disease of heart
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    51422 (PRKAG2)
   04068 FoxO signaling pathway
    51422 (PRKAG2)
   04152 AMPK signaling pathway
    51422 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51422 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    51422 (PRKAG2)
   04922 Glucagon signaling pathway
    51422 (PRKAG2)
   04920 Adipocytokine signaling pathway
    51422 (PRKAG2)
   04921 Oxytocin signaling pathway
    51422 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    51422 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    51422 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    51422 (PRKAG2)
   04714 Thermogenesis
    51422 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    51422 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    51422 (PRKAG2)
   04931 Insulin resistance
    51422 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 51422
NCBI-ProteinID: NP_057287
OMIM: 602743
HGNC: 9386
Ensembl: ENSG00000106617
Vega: OTTHUMG00000157324
Pharos: Q9UGJ0(Tbio)
UniProt: Q9UGJ0 A0A090N8Q6
LinkDB All DBs
Position
7q36.1
AA seq 569 aa AA seqDB search
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcgcggttatggacaccaagaagaaaaaagatgtttccagccccggcgggagc
ggcggcaagaaaaatgccagccagaagaggcgttcgctgcgcgtgcacattccggacctg
agctccttcgccatgccgctcctggacggagacctggagggttccggaaagcattcctct
cgaaaggtggacagccccttcggcccgggcagcccctccaaagggttcttctccagaggc
ccccagccccggccctccagccccatgtctgcacctgtgaggcccaagaccagccccggc
tctcccaaaaccgtgttcccgttctcctaccaggagtccccgccacgctcccctcgacgc
atgagcttcagtgggatcttccgctcctcctccaaagagtcttcccccaactccaaccct
gctacctcgcccgggggcatcaggtttttctcccgctccagaaaaacctccggcctctcc
tcctctccgtcaacacccacccaagtgaccaagcagcacacgtttcccctggaatcctat
aagcacgagcctgaacggttagagaatcgcatctatgcctcgtcttcccccccggacaca
gggcagaggttctgcccgtcttccttccagagcccgaccaggcctccactggcatcaccg
acacactatgctccctccaaagccgcggcgctggcggcggccctgggacccgcggaagcc
ggcatgctggagaagctggagttcgaggacgaagcagtagaagactcagaaagtggtgtt
tacatgcgattcatgaggtcacacaagtgttatgacatcgttccaaccagttcaaagctt
gttgtctttgatactacattacaagttaaaaaggccttctttgctttggtagccaacggt
gtccgagcagcgccactgtgggagagtaaaaaacaaagttttgtaggaatgctaacaatt
acagatttcataaatatactacatagatactataaatcacctatggtacagatttatgaa
ttagaggaacataaaattgaaacatggagggagctttatttacaagaaacatttaagcct
ttagtgaatatatctccagatgcaagcctcttcgatgctgtatactccttgatcaaaaat
aaaatccacagattgcccgttattgaccctatcagtgggaatgcactttatatacttacc
cacaaaagaatcctcaagttcctccagctttttatgtctgatatgccaaagcctgccttc
atgaagcagaacctggatgagcttggaataggaacgtaccacaacattgccttcatacat
ccagacactcccatcatcaaagccttgaacatatttgtggaaagacgaatatcagctctg
cctgttgtggatgagtcaggaaaagttgtagatatttattccaaatttgatgtaattaat
cttgctgctgagaaaacatacaataacctagatatcacggtgacccaggcccttcagcac
cgttcacagtattttgaaggtgttgtgaagtgcaataagctggaaatactggagaccatc
gtggacagaatagtaagagctgaggtccatcggctggtggtggtaaatgaagcagatagt
attgtgggtattatttccctgtcggacattctgcaagccctgatcctcacaccagcaggt
gccaaacaaaaggagacagaaacggagtga

KEGG   Homo sapiens (human): 53632Help
Entry
53632             CDS       T01001                                 

Gene name
PRKAG3, AMPKG3
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    53632 (PRKAG3)
   04068 FoxO signaling pathway
    53632 (PRKAG3)
   04152 AMPK signaling pathway
    53632 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53632 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    53632 (PRKAG3)
   04922 Glucagon signaling pathway
    53632 (PRKAG3)
   04920 Adipocytokine signaling pathway
    53632 (PRKAG3)
   04921 Oxytocin signaling pathway
    53632 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    53632 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    53632 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    53632 (PRKAG3)
   04714 Thermogenesis
    53632 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    53632 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    53632 (PRKAG3)
   04931 Insulin resistance
    53632 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 53632
NCBI-ProteinID: NP_059127
OMIM: 604976
HGNC: 9387
Ensembl: ENSG00000115592
Vega: OTTHUMG00000133078
Pharos: Q9UGI9(Tbio)
UniProt: Q9UGI9 A0A024R426
LinkDB All DBs
Position
2q35
AA seq 489 aa AA seqDB search
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgggctggagcacgcactgcgcaggaccccttcctggagcagccttgggggt
tctgagcatcaagagatgagcttcctagagcaagaaaacagcagctcatggccatcacca
gctgtgaccagcagctcagaaagaatccgtgggaaacggagggccaaagccttgagatgg
acaaggcagaagtcggtggaggaaggggagccaccaggtcagggggaaggtccccggtcc
aggccagctgctgagtccaccgggctggaggccacattccccaagaccacacccttggct
caagctgatcctgccggggtgggcactccaccaacagggtgggactgcctcccctctgac
tgtacagcctcagctgcaggctccagcacagatgatgtggagctggccacggagttccca
gccacagaggcctgggagtgtgagctagaaggcctgctggaagagaggcctgccctgtgc
ctgtccccgcaggccccatttcccaagctgggctgggatgacgaactgcggaaacccggc
gcccagatctacatgcgcttcatgcaggagcacacctgctacgatgccatggcaactagc
tccaagctagtcatcttcgacaccatgctggagatcaagaaggccttctttgctctggtg
gccaacggtgtgcgggcagcccctctatgggacagcaagaagcagagctttgtggggatg
ctgaccatcactgacttcatcctggtgctgcatcgctactacaggtcccccctggtccag
atctatgagattgaacaacataagattgagacctggagggagatctacctgcaaggctgc
ttcaagcctctggtctccatctctcctaatgatagcctgtttgaagctgtctacaccctc
atcaagaaccggatccatcgcctgcctgttcttgacccggtgtcaggcaacgtactccac
atcctcacacacaaacgcctgctcaagttcctgcacatctttggttccctgctgccccgg
ccctccttcctctaccgcactatccaagatttgggcatcggcacattccgagacttggct
gtggtgctggagacagcacccatcctgactgcactggacatctttgtggaccggcgtgtg
tctgcactgcctgtggtcaacgaatgtggtcaggtcgtgggcctctattcccgctttgat
gtgattcacctggctgcccagcaaacctacaaccacctggacatgagtgtgggagaagcc
ctgaggcagaggacactatgtctggagggagtcctttcctgccagccccacgagagcttg
ggggaagtgatcgacaggattgctcgggagcaggtacacaggctggtgctagtggacgag
acccagcatctcttgggcgtggtctccctctccgacatccttcaggcactggtgctcagc
cctgctggcatcgatgccctcggggcctga

KEGG   Homo sapiens (human): 5571Help
Entry
5571              CDS       T01001                                 

Gene name
PRKAG1, AMPKG
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit gamma 1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5571 (PRKAG1)
   04068 FoxO signaling pathway
    5571 (PRKAG1)
   04152 AMPK signaling pathway
    5571 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5571 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5571 (PRKAG1)
   04922 Glucagon signaling pathway
    5571 (PRKAG1)
   04920 Adipocytokine signaling pathway
    5571 (PRKAG1)
   04921 Oxytocin signaling pathway
    5571 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    5571 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    5571 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5571 (PRKAG1)
   04714 Thermogenesis
    5571 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    5571 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5571 (PRKAG1)
   04931 Insulin resistance
    5571 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 5571
NCBI-ProteinID: NP_002724
OMIM: 602742
HGNC: 9385
Ensembl: ENSG00000181929
Vega: OTTHUMG00000170406
Pharos: P54619(Tbio)
UniProt: P54619 A0A024R125
LinkDB All DBs
Structure
PDB: 

Position
12q13.12
AA seq 331 aa AA seqDB search
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtcatttcttcagatagctccccagctgtggaaaatgagcatcctcaagag
accccagaatccaacaatagcgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagctccaaattggttgtatttgatacgtccctgcaggtgaagaaagct
ttttttgctttggtgactaacggtgtacgagctgcccctttatgggatagtaagaagcaa
agttttgtgggcatgctgaccatcactgatttcatcaatatcctgcaccgctactataaa
tcagccttggtacagatctatgagctagaagaacacaagatagaaacttggagagaggtg
tatctccaggactcctttaaaccgcttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcggaacaagatccacaggctgccagttattgacccagaatca
ggcaatactttgtacatcctcacccacaagcgcattctgaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtccaagtctctggaagagctacagattggcacc
tatgccaatattgctatggttcgcactaccacccccgtctatgtggctctggggattttt
gtacagcatcgagtctcagccctgccagtggtggatgagaaggggcgtgtggtggacatc
tactccaagtttgatgttatcaatctggcagcagaaaagacctacaacaacctagatgta
tctgtgactaaagccttgcaacatcgatcacattactttgagggtgttctcaagtgctac
ctgcatgagactctggagaccatcatcaacaggctagtggaagcagaggttcaccgactt
gtagtggtggatgaaaatgatgtggtcaagggaattgtatcactgtctgacatcctgcag
gccctggtgctcacaggtggagagaagaagccctga

DBGET integrated database retrieval system