KEGG   Homo sapiens (human): 51478
Entry
51478             CDS       T01001                                 

Gene name
HSD17B7, PRAP, SDR37C1
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 7
  KO
K13373  17beta-estradiol 17-dehydrogenase / 3beta-hydroxysteroid 3-dehydrogenase [EC:1.1.1.62 1.1.1.270]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
Module
hsa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    51478 (HSD17B7)
   00140 Steroid hormone biosynthesis
    51478 (HSD17B7)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    51478 (HSD17B7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     51478 (HSD17B7)
    1.1.1.270  3beta-hydroxysteroid 3-dehydrogenase
     51478 (HSD17B7)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 Sacchrp_dh_NADP GDP_Man_Dehyd Eno-Rase_NADH_b Polysacc_synt_2
Other DBs
NCBI-GeneID: 51478
NCBI-ProteinID: NP_057455
OMIM: 606756
HGNC: 5215
Ensembl: ENSG00000132196
Vega: OTTHUMG00000034420
Pharos: P56937(Tchem)
UniProt: P56937 A0A024R913
LinkDB
Position
1q23.3
AA seq 341 aa
MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIV
QVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTA
EGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFS
LEDFQHSKGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGILPPFIW
TLLMPAILLLRFFANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQ
KMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcgaaaggtggttttgatcaccggggctagcagtggcattggcctggccctctgcaag
cggctgctggcggaagatgatgagcttcatctgtgtttggcgtgcaggaacatgagcaag
gcagaagctgtctgtgctgctctgctggcctctcaccccactgctgaggtcaccattgtc
caggtggatgtcagcaacctgcagtcggtcttccgggcctccaaggaacttaagcaaagg
tttcagagattagactgtatatatctaaatgctgggatcatgcctaatccacaactaaat
atcaaagcacttttctttggcctcttttcaagaaaagtgattcatatgttctccacagct
gaaggcctgctgacccagggtgataagatcactgctgatggacttcaggaggtgtttgag
accaatgtctttggccattttatcctgattcgggaactggagcctctcctctgtcacagt
gacaatccatctcagctcatctggacatcatctcgcagtgcaaggaaatctaatttcagc
ctcgaggacttccagcacagcaaaggcaaggaaccctacagctcttccaaatatgccact
gaccttttgagtgtggctttgaacaggaacttcaaccagcagggtctctattccaatgtg
gcctgtccaggtacagcattgaccaatttgacatatggaattctgcctccgtttatatgg
acgctgttgatgccggcaatattgctacttcgcttttttgcaaatgcattcactttgaca
ccatataatggaacagaagctctggtatggcttttccaccaaaagcctgaatctctcaat
cctctgatcaaatatctgagtgccaccactggctttggaagaaattacattatgacccag
aagatggacctagatgaagacactgctgaaaaattttatcaaaagttactggaactggaa
aagcacattagggtcactattcaaaaaacagataatcaggccaggctcagtggctcatgc
ctataa

DBGET integrated database retrieval system