KEGG   Homo sapiens (human): 51510Help
Entry
51510             CDS       T01001                                 

Gene name
CHMP5, C9orf83, CGI-34, HSPC177, PNAS-2, SNF7DC2, Vps60
Definition
(RefSeq) charged multivesicular body protein 5
  KO
K12198  charged multivesicular body protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51510 (CHMP5)
  09143 Cell growth and death
   04217 Necroptosis
    51510 (CHMP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51510 (CHMP5)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    51510 (CHMP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 NPV_P10 Prefoldin_2 Spc7 Alpha-E DUF948 BCDHK_Adom3 DUF848
Motif
Other DBs
NCBI-GeneID: 51510
NCBI-ProteinID: NP_057494
OMIM: 610900
HGNC: 26942
Ensembl: ENSG00000086065
Vega: OTTHUMG00000019765
Pharos: Q9NZZ3(Tbio)
UniProt: Q9NZZ3
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 219 aa AA seqDB search
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgactcttcgggaaagcgaaacccaaggctccgccgcccagcctgactgactgc
attggcacggtggacagtagagcagaatccattgacaagaagatttctcgattggatgct
gagctagtgaagtataaggatcagatcaagaagatgagagagggtcctgcaaagaatatg
gtcaagcagaaagccttgcgagttttaaagcaaaagaggatgtatgagcagcagcgggac
aatcttgcccaacagtcattcaacatggaacaagccaattataccatccagtctttgaag
gacaccaagaccacggttgatgctatgaaactgggagtaaaggaaatgaagaaggcatac
aagcaagtgaagatcgaccagattgaggatttacaagaccagctagaggatatgatggaa
gatgcaaatgaaatccaagaagcactgagtcgcagttatggcaccccagaactggatgaa
gatgatttagaagcagagttggatgcactaggtgatgagcttctggctgatgaagacagt
tcttatttggatgaggcagcatctgcacctgcaattccagaaggtgttcccactgataca
aaaaacaaggatggagttctggtggatgaatttggattgccacagatccctgcttcatag

DBGET integrated database retrieval system