KEGG   Homo sapiens (human): 51534Help
Entry
51534             CDS       T01001                                 

Gene name
VTA1, C6orf55, DRG-1, DRG1, HSPC228, LIP5, My012, SBP1
Definition
(RefSeq) vesicle trafficking 1
  KO
K12199  vacuolar protein sorting-associated protein VTA1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51534 (VTA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51534 (VTA1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    51534 (VTA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vta1 Vta1_C
Motif
Other DBs
NCBI-GeneID: 51534
NCBI-ProteinID: NP_057569
OMIM: 610902
HGNC: 20954
Ensembl: ENSG00000009844
Vega: OTTHUMG00000015707
Pharos: Q9NP79(Tbio)
UniProt: Q9NP79
LinkDB All DBs
Structure
PDB: 

Position
6q24.1-q24.2
AA seq 307 aa AA seqDB search
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFL
SKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
ASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENED
AGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQ
PTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALK
LLTTGRE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcttgcaccgctgcccccgctccccgcacagttcaagagcatacagcatcat
ctgaggacggctcaggagcatgacaagcgagaccctgtggtggcttattactgtcgttta
tacgcaatgcagactggaatgaagatcgatagtaaaactcctgaatgtcgcaaattttta
tcaaagttaatggatcagttagaagctctaaagaagcagttgggtgataatgaagctatt
actcaagaaatagtgggctgtgcccatttggagaattatgctttgaaaatgtttttgtat
gcagacaatgaagatcgtgctggacgatttcacaaaaacatgatcaagtccttctatact
gcaagtcttttgatagatgtcataacagtatttggagaactcactgatgaaaatgtgaaa
cacaggaagtatgccagatggaaggcaacatacatccataattgtttaaagaatggggag
actcctcaagcaggccctgttggaattgaagaagataatgatattgaagaaaatgaagat
gctggagcagcctctctgcccactcagccaactcagccatcatcatcttcaacttatgac
ccaagcaacatgccatcaggcaactatactggaatacagattcctccgggtgcacacgct
ccagctaatacaccagcagaagtgcctcacagcacaggtgtagcaagtaatactatccaa
cctactccacagactatacctgccattgatcccgcacttttcaatacaatttcccagggg
gatgttcgtctaaccccagaagactttgctagagctcagaagtactgcaaatatgctggc
agtgctttgcagtatgaagatgtaagcactgctgtccagaatctacaaaaggctctcaag
ttactgacgacaggcagagaatga

DBGET integrated database retrieval system