KEGG   Homo sapiens (human): 51555
Entry
51555             CDS       T01001                                 

Gene name
PEX5L, PEX5R, PEX5RP, PXR2, PXR2B, TRIP8b
Definition
(RefSeq) peroxisomal biogenesis factor 5 like
  KO
K13342  peroxin-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51555 (PEX5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51555 (PEX5L)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    51555 (PEX5L)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 TPR_14 TPR_19 TPR_17 TPR_9 TPR_12 TPR_16 TPR_20 ANAPC3
Other DBs
NCBI-GeneID: 51555
NCBI-ProteinID: NP_057643
OMIM: 611058
HGNC: 30024
Ensembl: ENSG00000114757
Vega: OTTHUMG00000157363
Pharos: Q8IYB4(Tbio)
UniProt: Q8IYB4
LinkDB
Position
3q26.33
AA seq 626 aa
MYQGHMQKSKEQGYGKLSSDEDLEIIVDQKQGKGSRAADKAVAMVMKEIPREESAEEKPL
LTMTSQLVNEQQESRPLLSPSIDDFLCETKSEAIARPVTSNTAVLTTGLDLLDLSEPVSQ
TQTKAKKSEPSSKTSSLKKKADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDV
KFHGDRNTKGHPMAERKSSSSRTGSKELLWSSEHRSQPELSGGKSALNSESASELELVAP
TQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQ
EAQNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDA
EAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNW
IKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGL
GVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPG
FIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSL
MDQPELFQAANLGDLDVLLRAFNLDP
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgtaccagggacacatgcagaaaagtaaagaacaaggatatggaaaactaagcagtgat
gaagacctcgaaataattgttgatcaaaagcagggaaaaggctctagggcggcagataag
gctgttgccatggtgatgaaggagataccgagggaggagtctgctgaagaaaagcccctc
cttactatgacatcacagctggtgaatgagcaacaagaaagcagacccctcctgagtccc
tccatcgatgactttctctgtgaaaccaaatcggaagcaatagcaaggccagtaacatcc
aatacagctgtattgaccactggcttagatctcctcgacctgagtgaaccagtctctcaa
acccaaaccaaagccaagaagtcagagccctcatcaaaaacctcatccctcaagaaaaag
gccgatggatctgacctcatcagcacggatgctgagcagagaggccagcctctcagagtc
ccggagacttcatccttagatctagacattcaaacacaactggaaaaatgggacgatgtt
aagtttcatggagatcgaaataccaagggacatccaatggcagagagaaaatcatcctca
tctagaactggatcaaaagagctcttatggtcctcagaacacagatctcaaccagaactg
agtggtggaaaaagcgccctcaactctgagtcggcttcagaattggaattagtggctccg
actcaggctcgactgaccaaagaacatcgctggggaagcgcattactttctagaaaccac
tccttagaagaagagtttgaaagggcaaaagcagcagtggagtcagatacagagttttgg
gataagatgcaagcagaatgggaagaaatggctcggaggaactggatatctgagaaccaa
gaagcccagaaccaagtaaccatctcggctagtgagaagggatattactttcacactgaa
aaccccttcaaggactggcctggagcatttgaagaaggcttaaaaaggctgaaggaaggg
gatctgccagtcaccatcctgttcatggaagcagcaattcttcaggaccctggagatgca
gaggcatggcagttcctcgggataacccaggcggagaatgaaaatgaacaagcagctatt
gtcgccctccagaggtgcttagaattacagcccaacaacttaaaagctttgatggccttg
gctgtgagttatactaacactggccatcagcaggatgcctgtgacgctctgaagaattgg
attaagcaaaatccaaagtacaaataccttgtgaaaagcaagaagggatctccaggcctc
acccggcggatgtctaagtccccagttgatagctctgttctggaaggggtgaaggaatta
tatctggaagctgcccaccaaaatggagatatgatcgacccagacctgcagacaggtcta
ggggttctgttccacctgagtggagaatttaatagagcaatagatgcatttaacgctgcc
ttaactgttcggccagaggactattcactatggaaccgcctcggggcgaccttggcgaac
ggagaccgcagcgaggaagccgtggaggcctatacgcgagcactggagattcagccagga
ttcatccggtccagatacaacctaggaataagctgcatcaacctgggcgcctacagagaa
gcggtcagcaattttctcactgccctcagtttgcaaagaaagagcaggaatcagcagcaa
gttcctcatcctgcaatctctgggaatatctgggctgccctcagaattgcgctctctctg
atggaccaaccagaactcttccaggcggctaatcttggtgacctggatgtcctcttaaga
gctttcaacttggatccttga

KEGG   Homo sapiens (human): 5830
Entry
5830              CDS       T01001                                 

Gene name
PEX5, PBD2A, PBD2B, PTS1-BP, PTS1R, PXR1, RCDP5
Definition
(RefSeq) peroxisomal biogenesis factor 5
  KO
K13342  peroxin-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00177  Neonatal adrenoleukodystrophy
H00205  Peroxisome biogenesis disorder
H00207  Rhizomelic chondrodysplasia punctata
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5830 (PEX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5830 (PEX5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    5830 (PEX5)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_17 TPR_14 TPR_16 TPR_19 TPR_12 TPR_7 TPR_9 TPR_20 TPR_10 ANAPC3 DUF1641
Other DBs
NCBI-GeneID: 5830
NCBI-ProteinID: NP_001124497
OMIM: 600414
HGNC: 9719
Ensembl: ENSG00000139197
Vega: OTTHUMG00000168175
Pharos: P50542(Tbio)
UniProt: P50542 A0A0S2Z4H1 B4DR50
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 639 aa
MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAASKPLGVASED
ELVAEFLQDQNAPLVSRAPQTFKMDDLLAEMQQIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTA
TDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVSLESGAGSGRAQA
EQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAK
RDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEA
AVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQR
QACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVR
LDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEE
AVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMS
ENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcaatgcgggagctggtggaggccgaatgcgggggtgccaacccgctcatgaagctc
gccgggcacttcacccaggacaaggcccttcggcaggagggattgaggcctggcccctgg
ccccccggagccccggcctctgaggcagcctccaagcctttgggagtagcttctgaagat
gagttggtggctgaattcctgcaggaccagaatgcaccccttgtgtcccgtgcccctcag
accttcaagatggatgacctcctggctgagatgcagcagattgagcagtcaaacttccgc
caggctccccagagagcccctggtgtggcagacttggccttgtctgagaactgggcccag
gagtttcttgcagctggagatgctgtggatgtaactcaggattataatgagactgactgg
tcccaagaattcatctctgaagttacagaccccttgtctgtgtcccctgcccgctgggct
gaggaatatttggagcaatcagaggagaagctgtggctgggagaacctgagggaacagcc
accgatcgctggtatgatgaatatcatcctgaggaggatctgcagcacacggccagtgac
tttgtggccaaagtggatgaccccaaattggctaattctgagttcctgaaattcgtgcgg
cagattggcgaagggcaggtgtccctggagtccggtgcagggtcgggccgagctcaggca
gaacagtgggcagcagagtttatacagcagcagggtacatcagatgcctgggttgaccag
ttcacaagaccagtaaacacatctgcccttgatatggagtttgaacgagccaagtcagct
atagagtctgatgtcgatttctgggacaagttgcaggcagagttggaggagatggcaaaa
cgggatgctgaggcccacccctggctttctgactatgatgaccttacgtcagctacctat
gataaggggtaccagtttgaggaggagaaccccttgcgtgatcaccctcagccttttgaa
gaagggctgcggcgccttcaggagggggacctgccaaatgctgtgctgctttttgaggca
gctgtgcagcaggatcctaagcacatggaagcttggcagtatctgggtaccacccaggca
gagaatgaacaagaactattagccatcagtgcattgcggaggtgtctggagctaaagcca
gataaccagacagcactgatggcgctggctgtgagcttcaccaacgagtccctgcagcga
caggcctgtgaaaccctacgagactggctgcggtacacaccagcctatgcccatctggtg
acacctgctgaagaaggggctggtggggcaggactgggccccagcaagcgtatcctggga
tctctcttgtctgactccctgtttcttgaagtgaaagagctcttcctggcagctgtgcgg
ctggaccctacctccattgaccctgatgtgcagtgtggcttgggagtccttttcaacctg
agtggggagtatgacaaggccgtggactgcttcacagctgccctcagcgttcgtcccaat
gactatttgctgtggaataagctaggcgccaccctggccaatggaaaccagagtgaagaa
gcagtagctgcgtaccgccgggccctcgagctccagcctggctatatccggtcccgctat
aacctgggcatcagctgcatcaacctcggggctcaccgggaggctgtggagcactttctg
gaggccctgaacatgcagaggaaaagccggggcccccggggtgaaggaggtgccatgtcg
gagaacatctggagcaccctgcgtttggcattgtctatgttaggccagagcgatgcctat
ggggcagccgacgcgcgggatctgtccaccctcctaactatgtttggcctgccccagtga

DBGET integrated database retrieval system