KEGG   Homo sapiens (human): 5159Help
Entry
5159              CDS       T01001                                 

Gene name
PDGFRB, CD140B, IBGC4, IMF1, JTK12, KOGS, PDGFR, PDGFR-1, PDGFR1, PENTT
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  Jak-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
Network
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00190  HPV E5 to host-cell-protein activation
Disease
H00042  Glioma
H01574  Familial idiopathic basal ganglia calcification
H01910  Infantile myofibromatosis
Drug target
Becaplermin: D03065
Cabozantinib (DG01670): D10062 D10095
Crenolanib (DG01361): D10102 D10103
Dasatinib (DG00714): D03658 D06414
Dovitinib lactate: D08907
Ilorasertib: D10423
Linifanib: D09635
Midostaurin: D05029
Motesanib (DG01262): D06678 D08947
Nilotinib (DG00716): D06413 D08953
Nintedanib (DG01374): D10396 D10481
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Toceranib (DG01363): D08503 D08544
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5159 (PDGFRB)
   04015 Rap1 signaling pathway
    5159 (PDGFRB)
   04010 MAPK signaling pathway
    5159 (PDGFRB)
   04630 Jak-STAT signaling pathway
    5159 (PDGFRB)
   04020 Calcium signaling pathway
    5159 (PDGFRB)
   04072 Phospholipase D signaling pathway
    5159 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    5159 (PDGFRB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5159 (PDGFRB)
   04540 Gap junction
    5159 (PDGFRB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    5159 (PDGFRB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5159 (PDGFRB)
   05230 Central carbon metabolism in cancer
    5159 (PDGFRB)
   05231 Choline metabolism in cancer
    5159 (PDGFRB)
   05206 MicroRNAs in cancer
    5159 (PDGFRB)
   05214 Glioma
    5159 (PDGFRB)
   05218 Melanoma
    5159 (PDGFRB)
   05215 Prostate cancer
    5159 (PDGFRB)
  Infectious diseases
   05166 HTLV-I infection
    5159 (PDGFRB)
   05165 Human papillomavirus infection
    5159 (PDGFRB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5159 (PDGFRB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5159 (PDGFRB)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   5159 (PDGFRB)
CD molecules [BR:hsa04090]
 Proteins
  5159 (PDGFRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig I-set Ig_2 V-set C1-set TrmE_N Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5159
NCBI-ProteinID: NP_002600
OMIM: 173410
HGNC: 8804
Ensembl: ENSG00000113721
Vega: OTTHUMG00000130053
Pharos: P09619(Tclin)
UniProt: P09619 Q59F04
LinkDB All DBs
Structure
PDB: 

Position
5q32
AA seq 1106 aa AA seqDB search
MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggcgagctgctgttgctgtct
ctcctgttacttctggaaccacagatctctcagggcctggtcgtcacacccccggggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctcgggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctcacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagaccgatgagcggaaacggctctacatctttgtg
ccagatcccaccgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacgttgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tctgatgcctactatgtctacagactccaggtgtcatccatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgactgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagcggctacgtgcggctcctggga
gaggtgggcacactacaatttgctgagctgcatcggagccggacactgcaggtagtgttc
gaggcctacccaccgcccactgtcctgtggttcaaagacaaccgcaccctgggcgactcc
agcgctggcgaaatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggatgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagtggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgtgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagactaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactccgacaagcgccgcccgcccagcgcggagctctacagcaatgctctg
cccgttgggctccccctgcccagccatgtgtccttgaccggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaactacatggccccttacgataactacgttccc
tctgcccctgagaggacctgccgagcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttaaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaacgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggacgaaccagagccagagccccagcttgagctccaggtg
gagccggagccagagctggaacagttgccggattcggggtgccctgcgcctcgggcggaa
gcagaggatagcttcctgtag

DBGET integrated database retrieval system