KEGG   Homo sapiens (human): 5162Help
Entry
5162              CDS       T01001                                 

Gene name
PDHB, PDHBD, PDHE1-B, PDHE1B, PHE1B
Definition
(RefSeq) pyruvate dehydrogenase E1 beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04066  HIF-1 signaling pathway
hsa04922  Glucagon signaling pathway
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H01998  Pyruvate dehydrogenase E1-beta deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5162 (PDHB)
   00020 Citrate cycle (TCA cycle)
    5162 (PDHB)
   00620 Pyruvate metabolism
    5162 (PDHB)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5162 (PDHB)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5162 (PDHB)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5162 (PDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     5162 (PDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-GeneID: 5162
NCBI-ProteinID: NP_000916
OMIM: 179060
HGNC: 8808
Ensembl: ENSG00000168291
Vega: OTTHUMG00000159157
Pharos: P11177(Tbio)
UniProt: P11177
LinkDB All DBs
Structure
PDB: 

Position
3p14.3
AA seq 359 aa AA seqDB search
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgtctggcttggtgcggagaccccttcgggaggtctccgggctgctgaag
aggcgctttcactggaccgcgccggctgcgctgcaggtgacagttcgtgatgctataaat
cagggtatggatgaggagctggaaagagatgagaaggtatttctgcttggagaagaagtt
gcccagtatgatggggcatacaaggttagtcgagggctgtggaagaaatatggagacaag
aggattattgacactcccatatcagagatgggctttgctggaattgctgtaggtgcagct
atggctgggttgcggcccatttgtgaatttatgaccttcaatttctccatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtctggtggccttcagcctgtg
cctatagtcttcagggggcccaatggtgcctcagcaggtgtagctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagtccctggaattca
gaggatgctaaaggacttattaaatcagccattcgggataacaatccagtggtggtgcta
gagaatgaattgatgtatggggttccttttgaatttcctccggaagctcagtcaaaagat
tttctgattcctattggaaaagccaaaatagaaaggcaaggaacacatataactgtggtt
tcccattcaagacctgtgggccactgcttagaagctgcagcagtgctatctaaagaagga
gttgaatgtgaggtgataaatatgcgtaccattagaccaatggacatggaaaccatagaa
gccagtgtcatgaagacaaatcatcttgtaactgtggaaggaggctggccacagtttgga
gtaggagctgaaatctgtgccaggatcatggaaggtcctgcgttcaatttcctggatgct
cctgctgttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaggac
aactctatacctcaggtcaaagacatcatatttgcaataaagaaaacattaaatatttag

DBGET integrated database retrieval system