KEGG   Homo sapiens (human): 51655
Entry
51655             CDS       T01001                                 

Gene name
RASD1, AGS1, DEXRAS1, MGC:26290
Definition
(RefSeq) ras related dexamethasone induced 1
  KO
K07843  RAS, dexamethasone-induced Ras-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04713  Circadian entrainment
hsa04934  Cushing syndrome
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
Disease
H01102  Pituitary adenomas
H01431  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    51655 (RASD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    51655 (RASD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    51655 (RASD1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   RasD
    51655 (RASD1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB TniB AAA_24 MMR_HSR1
Other DBs
NCBI-GeneID: 51655
NCBI-ProteinID: NP_057168
OMIM: 605550
HGNC: 15828
Ensembl: ENSG00000108551
Vega: OTTHUMG00000059292
Pharos: Q9Y272(Tbio)
UniProt: Q9Y272
LinkDB
Position
17p11.2
AA seq 281 aa
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQ
ILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKK
NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPG
DAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaaactggccgcgatgatcaagaagatgtgcccgagcgactcggagctgagtatcccg
gccaagaactgctatcgcatggtcatcctcggctcgtccaaggtgggcaagacggccatc
gtgtcgcgcttcctcaccggccgcttcgaggacgcctacacgcctaccatcgaggacttc
caccgcaagttctactccatccgcggcgaggtctaccagctcgacatcctcgacacgtcc
ggcaaccacccgttccccgccatgcggcgcctctccatcctcacaggagacgttttcatc
ctggtgttcagtctggacaaccgcgactccttcgaggaggtgcagcggctcaggcagcag
atcctcgacaccaagtcttgcctcaagaacaaaaccaaggagaacgtggacgtgcccctg
gtcatctgcggcaacaagggtgaccgcgacttctaccgcgaggtggaccagcgcgagatc
gagcagctggtgggcgacgacccccagcgctgcgcctacttcgagatctcggccaagaag
aacagcagcctggaccagatgttccgcgcgctcttcgccatggccaagctgcccagcgag
atgagcccagacctgcaccgcaaggtctcggtgcagtactgcgacgtgctgcacaagaag
gcgctgcggaacaagaagctgctgcgggccggcagcggcggcggcggcggcgacccgggc
gacgcctttggcatcgtggcacccttcgcgcgccggcccagcgtacacagcgacctcatg
tacatccgcgagaaggccagcgccggcagccaggccaaggacaaggagcgctgcgtcatc
agctag

DBGET integrated database retrieval system