KEGG   Homo sapiens (human): 51699Help
Entry
51699             CDS       T01001                                 

Gene name
VPS29, DC15, DC7, PEP11
Definition
(RefSeq) VPS29 retromer complex component
  KO
K18467  vacuolar protein sorting-associated protein 29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    51699 (VPS29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51699 (VPS29)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    51699 (VPS29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 51699
NCBI-ProteinID: NP_057310
OMIM: 606932
HGNC: 14340
Ensembl: ENSG00000111237
Vega: OTTHUMG00000169527
Pharos: Q9UBQ0(Tbio)
UniProt: Q9UBQ0
LinkDB All DBs
Structure
PDB: 

Position
12q24.11
AA seq 182 aa AA seqDB search
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR
GDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFE
AFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYK
KP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgttggtattaggagatctgcacatcccacaccggtgcaacagtttgccagct
aaattcaaaaaactcctggtgccaggaaaaattcagcacattctctgcacaggaaacctt
tgcaccaaagagagttatgactatctcaagactctggctggtgatgttcatattgtgaga
ggagacttcgatgagaatctgaattatccagaacagaaagttgtgactgttggacagttc
aaaattggtctgatccatggacatcaagttattccatggggagatatggccagcttagcc
ctgttgcagaggcaatttgatgtggacattcttatctcgggacacacacacaaatttgaa
gcatttgagcatgaaaataaattctacattaatccaggttctgccactggggcatataat
gccttggaaacaaacattattccatcatttgtgttgatggatatccaggcttctacagtg
gtcacctatgtgtatcagctaattggagatgatgtgaaagtagaacgaatcgaatacaaa
aaaccttaa

DBGET integrated database retrieval system