KEGG   Homo sapiens (human): 51735
Entry
51735             CDS       T01001                                 

Gene name
RAPGEF6, KIA001LB, PDZ-GEF2, PDZGEF2, RA-GEF-2, RAGEF2
Definition
(RefSeq) Rap guanine nucleotide exchange factor 6
  KO
K08020  Rap guanine nucleotide exchange factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    51735 (RAPGEF6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51735 (RAPGEF6)
SSDB
Motif
Pfam: RasGEF PDZ RasGEF_N RA cNMP_binding PDZ_6 PDZ_2 Tcp10_C
Other DBs
NCBI-GeneID: 51735
NCBI-ProteinID: NP_057424
OMIM: 610499
HGNC: 20655
Ensembl: ENSG00000158987
Vega: OTTHUMG00000162683
Pharos: Q8TEU7(Tbio)
UniProt: Q8TEU7
LinkDB
Structure
PDB: 
2D93

Position
5q31.1
AA seq 1601 aa
MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQVLFCSETIARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
AKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYLSLPADLTKMHLTENPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYMHGIVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQNFENITFMKAVEILRN
NTHLALTVKTNIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSIQHVPGDIEQTSQEKG
SKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYIIISKDTTAKEVVFHA
VHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELVKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLNSKTGNTHL
KRFEDIVNQETFWVASEILTEANQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
SVARLRGTWEKLPSKYEKHLQDLQDIFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLD
VQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGT
LTKNLSEKRSAKSSEMSPVPMRSAGQTTKAHLHQPHRVSQVLQVPAVNLHPIRKKGQTKD
PALNTSLPQKVLGTTEEISGKKHTEDTISVASSLHSSPPASPQGSPHKGYTLIPSAKSDN
LSDSSHSEISSRSSIVSNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHS
QHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADSGRGSWTSCSSSSHDNFQSLP
NPKSWDFLNSYRHTHLDDPIAEVEPTDSEPYSCSKSCSRTCGQCKGSLERKSWTSSSSLS
DTYEPNYGTVKQRVLESTPAESSEGLDPKDATDPVYKTVTSSTEKGLIVYCVTSPKKDDR
YREPPPTPPGYLGISLADLKEGPHTHLKPPDYSVAVQRSKMMHNSLSRLPPASLSSNLVA
CVPSKIVTQPQRHNLQPFHPKLGDVTDADSEADENEQVSAV
NT seq 4806 nt   +upstreamnt  +downstreamnt
atgaactcacccgtggaccctggcgctaggcaggcgttgaggaagaagccacccgagcgg
actcccgaggacttaaatactatttattcttatcttcatggaatggaaatattatcaaat
ctcagggaacatcagcttagattaatgtctgcaagagcacgctatgagagatacagtggc
aatcaggttctcttttgttcagaaacgattgccagatgttggtatatcctactttctgga
tctgtgcttgtgaaaggctccatggtcttgcctccttgcagttttggtaagcagtttgga
ggaaaaagaggatgtgattgtcttgtattagagccttcagaaatgattgtggtagagaat
gccaaagataatgaagatagtattctacaaagagaaattcctgccagacaatcccgaaga
agatttcggaaaattaactataaaggagagcgccaaaccattactgatgatgtggaggtt
aacagctatctttctcttccagctgatcttaccaagatgcatctcacagaaaaccctcat
ccacaggtgactcatgtgtcttctagtcagtctggttgtagcattgccagtgactctgga
agcagcagtttatctgatatctatcaggctacggagagtgaggtaggagatgtagatttg
acacgtcttccagaaggacctgttgattctgaggatgacgaagaggaagatgaagagatt
gatcgaacagatccattgcaggggcgagatcttgttcgagaatgtcttgaaaaagaacct
gcagacaaaactgatgatgacattgaacaattgctggagtttatgcaccagctccctgca
tttgcaaacatgaccatgtctgtaaggagagaactctgctcagtgatgatttttgaagtg
gtagagcaggctggagctattattcttgaagatgggcaagagcttgactcatggtatgtt
attttaaacggcactgtggaaatcagtcatccagatggaaaagttgaaaatttgtttatg
ggaaatagttttggaattactcccactctggataagcagtacatgcatggaattgtcagg
actaaagtagatgattgtcagtttgtctgcatagcccagcaagattattggagaatttta
aaccatgtggaaaaaaatacccataaagttgaggaagagggagaaattgttatggtacat
gagcatcgggaactagaccggagtggaaccaggaaaggacacattgtgatcaaggcaaca
cctgagcgtctcataatgcatttaatagaagaacattccatcgtggatccaacttatata
gaagattttctattaacttacaggacatttcttgaaagtcctttggatgttgggatcaaa
ctattggaatggtttaagatcgacagcttaagagataaggtgacacggattgtattatta
tgggtaaataatcattttaatgattttgaaggtgaccctgctatgactcgatttctagag
gaatttgaaaaaaatctggaagatacaaagatgaatggtcatctccggttattgaatatt
gcctgtgctgcaaaggctaagtggagacaggttgtgctgcaaaaggcttcccgcgagtcc
cctctacaattcagccttaatggagggagtgagaagggatttggtatttttgttgaagga
gtagaacctggtagcaaagctgctgattcaggactgaaacgtggtgatcagattatggaa
gtaaatggacaaaactttgagaatattacatttatgaaagccgttgaaattttgaggaat
aatactcatcttgcacttactgtgaagaccaacatttttgtgttcaaagagttacttttt
aggactgaacaagagaaatctggtgttcctcatattcccaaaattgctgaaaaaaaaagt
aatcgccattctatccagcatgtgccaggagatattgaacagacatcacaggagaaagga
agtaagaaagttaaagcaaatactgtttcaggtggaagaaacaaaatcaggaagattttg
gataaaacacgatttagtatcttgcctccaaagctatttagtgatggaggcctaagccaa
tcacaagatgacagcattgtgggaacaaggcactgtaggcatagtctggctataatgccc
atccctggaacactctcatccagcagccctgatctcctgcagcctaccaccagtatgttg
gatttttccaatccttcagatatccctgatcaagttataagagttttcaaagtggatcag
caaagttgctacattatcatcagtaaagacaccacagctaaagaagtagtttttcatgct
gttcatgaatttggtttgaccggtgcatccgacacatattctctctgtgaagtttctgtt
actcctgagggtgtcataaaacagagaagacttccagatcagttctccaaattagctgat
agaattcaactcaatggaaggtattacttaaaaaataacatggaaacagaaaccttatgt
tcagatgaagatgctcaagaactagttaaggaaagccagctatccatgctgcagctcagt
accattgaggtggccacccagctgtcaatgagggactttgatttgtttcgtaatattgaa
ccgactgagtacatcgatgacctttttaagttaaattccaaaacaggaaatactcatttg
aagaggtttgaggacattgtaaaccaagagacattctgggttgcctcagaaattttaact
gaagcaaatcagctcaaacgaatgaagattattaagcattttattaaaattgcacttcat
tgtcgagaatgtaagaacttcaattccatgtttgcaataataagtggcttgaacctggca
tctgtagcaagactcagaggaacttgggaaaagttaccaagcaaatacgagaaacatctt
caagatctacaagacatttttgatccatctagaaacatggcaaagtatagaaatattctt
agtagtcaaagtatgcagcctccaattattccactcttccctgttgtcaagaaagatatg
acatttctacatgaaggaaatgactccaaagtagatggtttagtaaactttgagaagtta
agaatgatttccaaggaaatccgccaagttgttcgaatgacttctgctaacatggaccca
gctatgatgtttcgacagaggtcactgagtcaaggaagcacaaattcaaacatgctggat
gttcagggaggtgctcacaaaaaaagggcacgccgcagctctctgcttaatgccaagaag
ctatatgaggatgcccaaatggcaaggaaggtgaagcagtatctttccagtctcgatgta
gagacagatgaggagaagttccagatgatgtcattacagtgggagcctgcatatggtacc
ttgaccaagaatttaagtgagaaaagatcagccaaatcatctgaaatgtctccagtgcct
atgaggtcagctggccaaacaactaaagcccacttgcatcaaccccacagagtaagccag
gtgcttcaggtgccagctgttaatttgcaccccatcaggaagaagggacaaacaaaagac
cctgcactgaatacaagtttacctcagaaagttttaggaacaactgaagaaataagtggt
aagaagcatacagaagacactatttctgtggcgtcatctttacattctagtcctcctgca
tctcctcaaggctcccctcacaaaggttacacacttattccatcagctaaatctgacaac
ttgtctgactccagccatagtgagatttcttcacggtccagcatcgtgagcaattgttct
gttgactccatgtctgcagctctacaggatgaacggtgttcctctcaggccctggcagtc
cctgaatccactggggcattggaaaagacagagcacgcttcagggataggagatcatagt
caacatggccctgggtggacactcttgaagccatctctaatcaagtgtttagctgtctca
tcgtctgtgagcaatgaagagatttctcaagagcatatcattatagaagcagctgacagt
ggtcgtggaagttggacttcgtgttcaagcagctcccatgacaacttccaaagccttcca
aacccaaaaagctgggattttttgaactcttacagacatacccatttggatgaccccatt
gctgaagttgaacccactgactctgagccctattcctgttctaaaagctgctctagaact
tgtgggcagtgtaaaggaagcctagagagaaagagttggacctcctccagttctctgtct
gacacgtatgaaccaaactatgggacagttaaacagagagtattggagagcaccccagct
gagtcatctgaaggcttggaccccaaggatgccactgacccagtttataaaactgtcact
tcaagtacagaaaagggcttgattgtgtactgtgtcacctcacccaagaaggacgatagg
tatagggagccacctcccactcctccaggatatttggggatttctttagcggacctaaag
gaaggaccccacacacacctaaaacctccagattatagtgtggcagtgcagaggtcaaag
atgatgcataacagcctctctagactgccaccagcttctctcagtagcaacctcgtggcc
tgtgttccatcgaagattgtaactcagcctcagaggcataatttgcagccattccatcct
aaactaggagatgtgactgatgcagatagcgaagcagatgaaaatgaacaagtttcagca
gtctag

DBGET integrated database retrieval system