KEGG   Homo sapiens (human): 51738Help
Entry
51738             CDS       T01001                                 

Gene name
GHRL, MTLRP
Definition
(RefSeq) ghrelin and obestatin prepropeptide
  KO
K05254  ghrelin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H01703  Eating Disorders
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    51738 (GHRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51738 (GHRL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Motif
Other DBs
NCBI-GeneID: 51738
NCBI-ProteinID: NP_001289750
OMIM: 605353
HGNC: 18129
Ensembl: ENSG00000157017
Vega: OTTHUMG00000155360
Pharos: Q9UBU3(Tchem)
CPD: C16025 C16102
UniProt: Q9UBU3
LinkDB All DBs
Position
3p25.3
AA seq 117 aa AA seqDB search
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgccctccccagggaccgtctgcagcctcctgctcctcggcatgctctggctggacttg
gccatggcaggctccagcttcctgagccctgaacaccagagagtccagcagagaaaggag
tcgaagaagccaccagccaagctgcagccccgagctctagcaggctggctccgcccggaa
gatggaggtcaagcagaaggggcagaggatgaactggaagtccggttcaacgcccccttt
gatgttggaatcaagctgtcaggggttcagtaccagcagcacagccaggccctggggaag
tttcttcaggacatcctctgggaagaggccaaagaggccccagccgacaagtga

DBGET integrated database retrieval system